SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020379 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020379
Domain Number 1 Region: 38-99
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000952
Family Extracellular domain of cell surface receptors 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020379   Gene: ENSCPOG00000026482   Transcript: ENSCPOT00000019588
Sequence length 140
Comment pep:novel scaffold:cavPor3:scaffold_1:23228157:23229792:1 gene:ENSCPOG00000026482 transcript:ENSCPOT00000019588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AHPPAHTQLALCLCFLTVPWEISLSDLQEKDVEEFGSSGLQCPTCFAVRGRYCNSQLKWC
APNMLMCFEFSGIVKTGINNISVEVKKCIQADLCKEPLTSYLGFPVANKSGKCRSALRGG
AGVRPSAHVFLFLFLGKLLL
Download sequence
Identical sequences 10141.ENSCPOP00000020379 ENSCPOP00000020379 ENSCPOP00000020379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]