SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020420 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000020420
Domain Number - Region: 17-107
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00952
Family Snake venom toxins 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020420   Gene: ENSCPOG00000023706   Transcript: ENSCPOT00000022514
Sequence length 203
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:23384604:23392080:-1 gene:ENSCPOG00000023706 transcript:ENSCPOT00000022514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGTMRGTLSALAITAVQSLNCIQSNSFTNSYINVSASECPLNASTSCLSSWANSSLVSPI
DWWENGTCSVANCSGETDSLLPFTVHMSDGDRFNFRSQCCQGKMCNATSDTLDPPPEDLS
NTECLACSRPTTSCVEKPQKCYREHQIPFLKNSCNSDTATETLVLKGCSSTRTSTFWLLS
ARSQMVEGLTFKKVECIDASLVT
Download sequence
Identical sequences ENSCPOP00000020420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]