SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020426 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000020426
Domain Number - Region: 21-96
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0011
Family Snake venom toxins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020426   Gene: ENSCPOG00000021505   Transcript: ENSCPOT00000019711
Sequence length 98
Comment pep:novel scaffold:cavPor3:scaffold_19:20526415:20527740:-1 gene:ENSCPOG00000021505 transcript:ENSCPOT00000019711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKHLLLLLGLALLSGFLQALTCIHCNRTSVDGICQTRKSSCQTYGSQQCYLRKVYEDGI
FQYARQGCSDLCFPMIPMNERTRVEFICCDNEPFCNRL
Download sequence
Identical sequences 10141.ENSCPOP00000020426 ENSCPOP00000020426 ENSCPOP00000020426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]