SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020554 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020554
Domain Number 1 Region: 228-409
Classification Level Classification E-value
Superfamily vWA-like 1.78e-47
Family Integrin A (or I) domain 0.00087
Further Details:      
 
Domain Number 2 Region: 34-225
Classification Level Classification E-value
Superfamily vWA-like 2.23e-45
Family Integrin A (or I) domain 0.0000000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020554   Gene: ENSCPOG00000000912   Transcript: ENSCPOT00000024591
Sequence length 417
Comment pep:novel scaffold:cavPor3:scaffold_107:3998975:4000225:-1 gene:ENSCPOG00000000912 transcript:ENSCPOT00000024591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQPGGLVVPPTEAPLSATTPYLEDITELPMHDLYCSKLLDLVFLLDGSSKLSEADFEVLK
TFVVSVMERLHISQKRIRVAVVEYHDGSHAYLELKARKRPSELRRIAGQVKYVGSQVAST
SEVLKYTLFQIFGKIDRPEASRIVLLLTASSEPKEMARNLFRIVQNLKKKKVILMPVGIG
PHVNLQQIRLIEKQARQNKAFLLSGVDELEQRRDEIINYLCDHAPEAPPPTQHTQVAQVT
VGPGVSEVLTPGPERKSMVLDVVFVLEGSDKVGEANFNRSKEFMAEVIQRMDVSQDGIHV
TVLQYSYTVTVEYTFREAQSKGDVLQHVREIQFRGGNQTNTGLALQYVSEHSFSVGQGDR
EQAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPGANVQELQTISWPSTPIFIKDF
Download sequence
Identical sequences ENSCPOP00000020554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]