SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020671 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020671
Domain Number 1 Region: 17-88
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000000268
Family Snake venom toxins 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020671   Gene: ENSCPOG00000026667   Transcript: ENSCPOT00000026360
Sequence length 111
Comment pep:novel scaffold:cavPor3:scaffold_95:2076480:2079550:1 gene:ENSCPOG00000026667 transcript:ENSCPOT00000026360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LREGLVYVVPAFLVGALAQALQCHECFATEDCFQPVSCPANTRYCLTTWNSPPGEKTIII
KSCAYTCPGFQESLAASRASCCNTDLCNSTVSHSISWGLLALSIWAVYLSR
Download sequence
Identical sequences 10141.ENSCPOP00000020671 ENSCPOP00000020671 ENSCPOP00000020671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]