SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020681 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020681
Domain Number 1 Region: 218-393
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000628
Family Quinoprotein alcohol dehydrogenase-like 0.041
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000020681
Domain Number - Region: 35-62
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0562
Family Integrin alpha N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020681   Gene: ENSCPOG00000022395   Transcript: ENSCPOT00000020117
Sequence length 593
Comment pep:novel scaffold:cavPor3:scaffold_42:7097958:7113534:1 gene:ENSCPOG00000022395 transcript:ENSCPOT00000020117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSSSDCDSGGAESNETNSKWLDAHYDPMANIYTFSSCLALADLHGDGEYKLVVGDFG
PDGRNPHLKVLKGPTVLTESPLPALPAAAATFLMEQHQPRTPALALASGPCVYVYKNLRP
YFKFALSQLPPNPLEQDLWDQAKEDLIDPLTLKEMLEGIRQKAEIPLSVQSLRFLQLELN
EMEAFVNQNKSKPIKRQTVITTMITLKKNLADEDAISCLVLGTENKKLLIIDPEAFTVLA
EMDIPSVPVFLEASGQFDVGFQLAAACRNGNIYILKRDSKHPKYSIELNAQPVGLVRIHK
ILVVGSTQDSLHGFTHKGKKLWTVQMPATILTMNLLEQHSRSLQAVMVALANQEVRIYRD
KALLNVIRTPDTVTSLCFGRYGREDNTLIMITRGGGLIIKILKRTAVFVEGTGEVGPPPA
QAMKLNVPRKTRLYVDQTLREREAGTGMHQTFQTDLYLLRVRAARAYVQALESSLSPMSA
TAREPLKVHAVVQGLGPTFKLTLHLQNTSAARPVLGLLVCFLYDEALYALPRAFFKVPLL
VPGLSYPLETFVQSLSSKGTSDIIRVLVLREGQSAPLLSAHISMPVSEGLVAA
Download sequence
Identical sequences H0WCG0
XP_003468322.1.53824 ENSCPOP00000020681 10141.ENSCPOP00000020681 ENSCPOP00000020681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]