SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020695 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020695
Domain Number 1 Region: 26-103
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000122
Family Snake venom toxins 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020695   Gene: ENSCPOG00000022996   Transcript: ENSCPOT00000025874
Sequence length 129
Comment pep:known_by_projection scaffold:cavPor3:scaffold_70:8600805:8601194:-1 gene:ENSCPOG00000022996 transcript:ENSCPOT00000025874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGWLWLPLLLLATTLPQGTAGIKHCFFCELTDSLICPGTRMHCGDEEDCFTGRGVAQG
MGPVINKGCVRTTSCGREEPVSYMGLTYTLTTSCCSGHLCNRGSGPTGHLTVTAATSLVL
GLLLLRHLL
Download sequence
Identical sequences XP_013003413.1.53824 ENSCPOP00000020695 10141.ENSCPOP00000020695 ENSCPOP00000020695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]