SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020721 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020721
Domain Number 1 Region: 113-197
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000000288
Family Extracellular domain of cell surface receptors 0.036
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000020721
Domain Number - Region: 6-91
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00595
Family Extracellular domain of cell surface receptors 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020721   Gene: ENSCPOG00000021326   Transcript: ENSCPOT00000023579
Sequence length 236
Comment pep:known_by_projection scaffold:cavPor3:scaffold_80:4896905:4898454:-1 gene:ENSCPOG00000021326 transcript:ENSCPOT00000023579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPGSRALQCYSIEHVYSGPFDISNMQLPKISCPHACSEVIMSLDTGYRRPLTVLQKGCWE
GQKIGRVESPWMALPPDYTEVHGCKEDLCNTKLQTHDSIPDLSRAPNPQTLSGTECYMCL
GMHPEDCSLEKSLLVRCHGDQSVCYQGSGRMNTGNFSVPVYIRTCHRPSCIVEGSTSPWT
AIELQGECCKGNLCNGGSLNVTAAAATPLQAPHTLALLLTTALLASALGGPLGFSR
Download sequence
Identical sequences 10141.ENSCPOP00000020721 ENSCPOP00000020721 ENSCPOP00000020721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]