SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020784 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000020784
Domain Number - Region: 192-286
Classification Level Classification E-value
Superfamily SIS domain 0.0934
Family double-SIS domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020784   Gene: ENSCPOG00000023806   Transcript: ENSCPOT00000026442
Sequence length 296
Comment pep:novel scaffold:cavPor3:scaffold_59:8937219:8938239:1 gene:ENSCPOG00000023806 transcript:ENSCPOT00000026442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGHKSKRCAPKKHPKGKSDKKGGEVAEAVALRQEEEDHPPGTAFYSPPLTPWRRSPSA
GGLSADGSFCSSDLGSSCKYEECLSEISHGPDYLSEDTKCPIEALEWFILSKFHLKQPFT
RLELLLSVNQKYRIEFPEMFKNAREHLEAMFAVELREVDSYCHSYNLFSMLSLPNNGRVR
PGRGYPKCGLLMKILALILMKDHRASEEDVWKFLRRMQVYPDKRHIFFGNAMKLLTHDFV
RLKYLEYRQVPGCLFPHWEFLWGPQACTETNKEKIMKFLIRTNKSYPTYFSSLYED
Download sequence
Identical sequences ENSCPOP00000020784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]