SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020852 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020852
Domain Number 1 Region: 109-225
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.19e-24
Family N-acetyl transferase, NAT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020852   Gene: ENSCPOG00000024666   Transcript: ENSCPOT00000028316
Sequence length 245
Comment pep:known_by_projection scaffold:cavPor3:scaffold_24:250316:258630:1 gene:ENSCPOG00000024666 transcript:ENSCPOT00000028316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRPCVDCHAFEFMQRALQDLRKTAYSLDARREARGRLFQAYIPDAIPRGFTXGLRQATRA
RKLLYALAALCFAVTRSLLLTCLVPVGLLALRYYYSRKVILAYLDCALHTDMADIEQYYM
RPPGSCFWVAVLDGNVVGIVAARAHEEDNAVELLRMSVDSRFRGKGIAKALGRKVLEFAV
VHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRL
QLREE
Download sequence
Identical sequences ENSCPOP00000020852 ENSCPOP00000020852 10141.ENSCPOP00000020852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]