SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020907 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020907
Domain Number 1 Region: 83-156
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000541
Family N-acetyl transferase, NAT 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020907   Gene: ENSCPOG00000004948   Transcript: ENSCPOT00000025045
Sequence length 190
Comment pep:known_by_projection scaffold:cavPor3:scaffold_70:18712:19767:-1 gene:ENSCPOG00000004948 transcript:ENSCPOT00000025045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSHLSVREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFVLA
SFALALLLPVFLAVAAVKLGLRARWGSLPPPAGLGGPWVAVRGSGDVCGVLALAPGANSG
DGARVTRLSVSRWHRRRGVGRRLLAFAEARARAWAGGTGEPRARLVVPDQAEGGWGCMGY
TLVREFSKDL
Download sequence
Identical sequences ENSCPOP00000020907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]