SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020970 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020970
Domain Number 1 Region: 37-160
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.87e-22
Family Synaptotagmin-like (S variant) 0.035
Further Details:      
 
Domain Number 2 Region: 205-256
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000948
Family CUE domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020970   Gene: ENSCPOG00000020816   Transcript: ENSCPOT00000020377
Sequence length 259
Comment pep:known_by_projection scaffold:cavPor3:scaffold_67:17287:27946:-1 gene:ENSCPOG00000020816 transcript:ENSCPOT00000020377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISLSVSVPQGPLVLIGELPQDFLRITPMQYGGTLGTVGRLSITVVQAKLAKNYGMTRMDP
YCRLRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIFDERAFSMDDRIAWTH
ITIPESLKQGQVEDEWYSLSGRQGDDKEGMINLVMSYTSLPAAMMMPPQPVVLMPTVYQQ
GIGYVPITGMPTVCSPGMVPMAVPPPAVTVQPRCMEEDLKAIQDMFPNMDKEVIRSVLEA
QRGNKDAAINSLLQMGEES
Download sequence
Identical sequences 10141.ENSCPOP00000020970 ENSCPOP00000020970 ENSCPOP00000020970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]