SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000021019 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000021019
Domain Number 1 Region: 81-201
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.16e-24
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000021019   Gene: ENSCPOG00000020957   Transcript: ENSCPOT00000021764
Sequence length 222
Comment pep:novel scaffold:cavPor3:scaffold_37:15393916:15394664:1 gene:ENSCPOG00000020957 transcript:ENSCPOT00000021764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPHIRKYQERDRKPVVDLFYKGMVEHIPTTFRHLLRLPQTLLFLIGVPLCILLVSGSW
LLACVSSFTLLVFLWLLVGYSWKQYVVMCLRTDMADITKTYLSACDSCFWVAESGGQVVG
IVCTLPVENPPPGKKQLQLFHLSVSMEHRGEGIAKALIRTVLQFARDQGYGEVVLDTTLV
QQSALKLYLHMGFQETGQFFFSSIMRLLAVPTFHLTYHLPSS
Download sequence
Identical sequences 10141.ENSCPOP00000021019 ENSCPOP00000021019 ENSCPOP00000021019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]