SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000021110 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000021110
Domain Number - Region: 39-107
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00215
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000021110   Gene: ENSCPOG00000023729   Transcript: ENSCPOT00000027659
Sequence length 185
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:16666920:16674130:-1 gene:ENSCPOG00000023729 transcript:ENSCPOT00000027659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKMRLLAFVTLVLLAVTRAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVE
LSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDG
PVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTP
KTKKN
Download sequence
Identical sequences ENSCPOP00000021110 10141.ENSCPOP00000021110 ENSCPOP00000021110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]