SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000333 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000333
Domain Number 1 Region: 131-193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.07e-16
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 2 Region: 76-141
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000032
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 46-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000688
Family Complement control module/SCR domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000333   Gene: ENSCPOG00000000380   Transcript: ENSCPOT00000000383
Sequence length 249
Comment pep:known_by_projection scaffold:cavPor3:scaffold_12:15866043:15875184:-1 gene:ENSCPOG00000000380 transcript:ENSCPOT00000000383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCWIVSCLVFGWLTSASDAQSHPEIPSVKNSISIAEVVEGQIRGTYTCIQGYHLEGKKV
FFSNASEEWDASTTQCRLGHCPDPVLENGEFSSSGPVNVNDIIAFKCNDHYILKGSSWSQ
CLEDHSWASPFPICKSRDCDPPEKPAHGYFQGANFTSGSMVTYHCESRYRLVGTPKQQCV
DGEWSGAPPVCELIPRSGFEEALLAFQENTDLCSAIENFVRRVKENGLTMEELKYSLEIE
KAELMQKLL
Download sequence
Identical sequences ENSCPOP00000000333 ENSCPOP00000000333 10141.ENSCPOP00000000333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]