SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000592 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000592
Domain Number 1 Region: 80-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.47e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 222-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000373
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 3 Region: 136-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000201
Family EGF-type module 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000592
Domain Number - Region: 274-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00175
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 195-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00325
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000592   Gene: ENSCPOG00000000670   Transcript: ENSCPOT00000000675
Sequence length 440
Comment pep:known_by_projection scaffold:cavPor3:scaffold_73:7036728:7063471:-1 gene:ENSCPOG00000000670 transcript:ENSCPOT00000000675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSSPRALFLLLLLLACPESRASQNCLSQQQLLTAVRQLQQLLKAQEARFAEAMRSARS
RLAALQSSMGRLAPAAPPASCPPLSAPLDGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVV
CLPNGTWTAEQPRCREISECASQPCQHGGTCIEGVNQFRCLCPPGRTGVRCQHQGQTAAP
EVGVASDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAAGDGVCQDVNECELYAQEGRPRL
CMHACVNTPGSYRCSCPSGYQTLADGKSCEDVDECAGTQHVCPRETTCINTGGGFQCVSP
ECPEGNDNVSYVKTSPFQCERNPCPMDSRACRSMPKTISFHYLSLPSNLKTPITLFRMAT
ASAPSRSGPNSLRFGIVGGNSRGYFVMQRSDRQTGELILVQTLEGPQTLEVDVDMSEYLD
RSFQANHVSKVTIFVSPYDF
Download sequence
Identical sequences A0A286XD17
XP_003465111.1.53824 ENSCPOP00000000592 10141.ENSCPOP00000000592 ENSCPOP00000000592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]