SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001183 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001183
Domain Number 1 Region: 223-285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 2 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 3 Region: 154-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000153
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 36-99
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000249
Family Complement control module/SCR domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001183   Gene: ENSCPOG00000001306   Transcript: ENSCPOT00000001322
Sequence length 379
Comment pep:known scaffold:cavPor3:scaffold_12:15332868:15365116:-1 gene:ENSCPOG00000001306 transcript:ENSCPOT00000001322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPLHGESRAASWWRILGACLLAAVFLLAASSDACVLPPPFEAMEPINPKPYYEIGEKV
EYRCKKGYLRQPFYLMVATCEKNHSWVPITDDGCIKKQCTYLNPPPKGRVEYINGTRTWG
DIVHFSCVEGFYVSGIAALSCELRGDNVDWNGRVPTCEKVLCSPPPKIQNGKYTFSDVQV
FEYFEAVTYSCDAVQGPDKLSLVGNEVLYCAGHQKWSSAAPECKVVKCPLPVVKNGKQIS
GLGQTFFYQATVTFQCLPGFYFNGSSTVVCGSDNTWKPSIPECLKGPKPTHPTKPPVYNY
PGYPNPREGIFDQELNLWIIILLILIAVVGLALILLCACRFFERKKKSPEKVMPAIQISD
HMVNAPILMPSTVQNPMKR
Download sequence
Identical sequences P70105
NP_001166399.2.53824 ENSCPOP00000001183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]