SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001198 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001198
Domain Number 1 Region: 559-782
Classification Level Classification E-value
Superfamily GFP-like 5.65e-81
Family Domain G2 of nidogen-1 0.000000716
Further Details:      
 
Domain Number 2 Region: 1144-1404
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-43
Family YWTD domain 0.000000117
Further Details:      
 
Domain Number 3 Region: 514-556,793-890
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.96e-20
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 1040-1121
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.75e-19
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 5 Region: 917-961
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000382
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000001198
Domain Number - Region: 893-922
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000729
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 932-1036
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0034
Family Thyroglobulin type-1 domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001198   Gene: ENSCPOG00000001320   Transcript: ENSCPOT00000001339
Sequence length 1415
Comment pep:known_by_projection scaffold:cavPor3:scaffold_23:17718517:17775901:-1 gene:ENSCPOG00000001320 transcript:ENSCPOT00000001339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACRDPLGEWLSPPRSSRRALGTVRLLPYRASALHTDQLFPYGESRGDLLLPEGDDESSAP
LQLGLPLRFLDAQFNSLYVGTNGIISTQDFPRETQYVDDDFPTDFPAIAPFLADIDTSRG
RGRVLFREDTSPAVLRLAGHYVSAGFPRSAASFNPTHTFLATWERVGAYEEVRHGAQPSG
ELNTFQVVLAYDRSDTFALFLYPANGLQFFGTRPKESYNVQLQLPARVGFCRGEAEDMKR
EGPYFSLTSTEQSVKNLYQLSNMGIPGVWAFHIGSSSPLDNFQPATVGGELSAARPGTPR
EHPTSHTAALEGDYTEGNLDYYDENEEEVEYPPSEPGETADNHSRVDVSFESRGDMGPLG
GGLSPPHPDLASSVPHPAPAVWPSHPETESANSDPWGKQTAPLGGEETSGIKGHVQPLDQ
EGTQGPALSEVHRESLAPSQEGPAPQPGDRSSVQPYSEARPEPSGPEHPAAHPQEGELPN
YAGPGHTPLVGGERPVVGVEDEISSNTEVFTYNSANKETCEHHHGQCSQHAFCTDYATGF
CCHCQSRFNGNGKHCLPEGAPHRVNGKVSGHLHVGHTPVHFSDVDLHAYIVSNDGRAYTA
ISHIPPPAAQALLPLTPIGGLFGWLFALEKPGFKNGFSLTGAAFVHNAEVTFYPGEERVW
ITQTAEGLDSENYLIMKTNIQGQVPAIPANFMAHIPPYKELYHYSDSAVTVTSSRDYSLT
FGALNQMGSYRIHQNITFQACRHAGRQAVPTPQQLSVDRVFALYSEDEGVLRFAVTNQIG
PVEVDSEPILVNPCYDGSHTCDSAARCHPGTGVDYTCACAPGYQGDGRSCEDVNECATGY
HRCGPNSVCINLPGSYRCECRSGYEFVEDQRMCVLIAPPPNPCEDGSHNCAPEGQARCIN
HGDGTFSCACLPGYTGSGYQCSDVDECAENRCHPAATCYNAPGSFSCVCQPGYLGDGFQC
THDCSLVAQGLSGSACALQSLWGLLCQPQHVYPGSQVHIPQYGELQLLPLQCHSSTGFCC
YVDQDGYEISGTWTPSHPGWTITCCSEPTQRPRTVCERWKESLLEHYGGTPRDDQYVPQC
DDLGHFTPLQCHGKSDFCWCVDKDGREVQGTRSQPGITPACIPTVAPPTMRPTPRPDVTP
PSVGTFLLYAQGQQIGHLPLNGTRLQKDAAKTLLSLHGSIVVGIDYDCRERMVYWTDVAG
RTISRASLEPGAEPETIINSGLMSPEGLAIDHFRRTMYWTDSGLDRIERARLDGSERKVL
FHTDLVNPRAIAVDPIQGNLYWTDWNREAPKIETSSLDGEDRRILVNKDIGLPNGLTFDP
FSKLLCWADAVLKGTKKLECTLPDGTGRRAIQNHLNYPFSIVSYADHFYHTDWRRDGVVS
VNKDSGQFIDEYLPEQRSHLYGITAVYPYCPPGKQ
Download sequence
Identical sequences ENSCPOP00000001198 10141.ENSCPOP00000001198 ENSCPOP00000001198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]