SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002409 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002409
Domain Number 1 Region: 264-456
Classification Level Classification E-value
Superfamily Nudix 1.11e-44
Family NADH pyrophosphatase 0.0011
Further Details:      
 
Domain Number 2 Region: 16-101
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.78e-20
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002409   Gene: ENSCPOG00000002651   Transcript: ENSCPOT00000002685
Sequence length 462
Comment pep:known_by_projection scaffold:cavPor3:scaffold_99:3788202:3797561:1 gene:ENSCPOG00000002651 transcript:ENSCPOT00000002685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGKGSPKQEMISEFHSAAAEGDIAKIIGILSHSPALLNETSENGWTALMYAARNGHPE
VVQFLLEKGCDRSVVNKSKQTALDIAVFWGYKHIANLLANAQGGKKPWFLTSDVEECDNY
FSKTLLDRKSEKRNNSDWLLAKESHPSTVYILFSDLNPLVTLGGNKESFQQPEVRLCRLS
YTDIKDYLAHPEKITLVFLGVELETKKQLNNHAAEVPREEEDGLVAWFALGIDPVAAEEF
KQRHENCYFLHPPMPALLQLKEREAGVVAQARSVLAWHSRYKFCPTCGSTTKIEEGGYKR
VCLKQDCPSLHGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFVEPG
ETIEDAVRREVEEESGVRVGHVQYVSCQPWPMPSSLMIGCLAVAVSTEIKVDKNEIEDAR
WFTREQVVDVLTRGKQQAFFVPPSRAIAHQLIKYWIGMNPNL
Download sequence
Identical sequences H0UZ17
10141.ENSCPOP00000002409 ENSCPOP00000002409 ENSCPOP00000002409 XP_003463588.1.53824 XP_013000980.1.53824 XP_013000981.1.53824 XP_013000982.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]