SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002439 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002439
Domain Number 1 Region: 498-527,568-624
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000133
Family Anti-sigma factor antagonist SpoIIaa 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002439   Gene: ENSCPOG00000002686   Transcript: ENSCPOT00000002720
Sequence length 652
Comment pep:known_by_projection scaffold:cavPor3:scaffold_0:23699463:23822236:-1 gene:ENSCPOG00000002686 transcript:ENSCPOT00000002720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAKRKKKSVLWSKMHTPHCEDIRQWCRRRLPILEWAPQYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAILSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAVERLVP
QSSQNLTMQNNSSLLGLSDFEVQRIGVAAAVSFLGGVIQVAMFVLQLGSATFLLTEPVIS
AMTTGAATHVVTSQVKYLLGIKIPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPKGIPPPSIP
PMNLLSAVVTEAFGVALVGYAASLALAQGSAKKFKYSVDDNQEFLAHGLSNVIPSFFYCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFILIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYIFTICFAANVGLLFGVACTIAILIGRFPRAKTLSI
KNMKEMEFKVKTETDNESTHQVKIISINNPLVFLNVKKFHIDLKNIIQRENATNHLLDDI
SKCEQNTLLNSLSSGSYNEDASQPCLTEKWSLILDCSGLTFFDYSGVSMLVEVYTDCKDM
NMDVSLASCPDSLIKAMKYCGNLDSERPSVSAAISNIYSNKSSNKLTDHSEV
Download sequence
Identical sequences 10141.ENSCPOP00000002439 ENSCPOP00000002439 ENSCPOP00000002439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]