SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002841 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002841
Domain Number 1 Region: 358-540
Classification Level Classification E-value
Superfamily NTF2-like 2.25e-61
Family NTF2-like 0.00000147
Further Details:      
 
Domain Number 2 Region: 92-186
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.9e-32
Family Non-canonical RBD domain 0.00012
Further Details:      
 
Domain Number 3 Region: 191-345
Classification Level Classification E-value
Superfamily L domain-like 3.74e-31
Family mRNA export factor tap 0.00000287
Further Details:      
 
Domain Number 4 Region: 537-573
Classification Level Classification E-value
Superfamily UBA-like 0.0000918
Family TAP-C domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002841   Gene: ENSCPOG00000003136   Transcript: ENSCPOT00000003179
Sequence length 573
Comment pep:novel scaffold:cavPor3:scaffold_26:2078775:2085277:1 gene:ENSCPOG00000003136 transcript:ENSCPOT00000003179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGTSALRRRRGNGRASYGNFDRRSTRHEHSRHGLLSSHFPKDDSNAIKDFYEDRRVRYIP
YVRQHHRSRGRGCDVHKSRVNVCRDPQLRDREMKMDTRDGTRQSWFKVTIPLGRTYDKTW
LMNLIQCHCSVSFSPVDFHYIENRALFFVQGVSTASAIKDASNKIYDEENQKIRIFVNPS
AVPYSVQNKFTPEQMKQLKLTMKKRYDVSQKALNLQKLRFDPDLMDHEIDIILNRRSCMV
AALKIIERNFPELLSLNLQNNKLYKLDGLSDIVEKGPQVKILNLSENELKSIRELDKVKG
LKLEELWLQGNPFCSKYADQSAYVSAIQDFFPKLLRLDGQELRPPTVNDIDLRKLVESCK
ESYKGSETLKNLILQFLQEYYLIYDYGERQGLLSAYHNEACFSLTIPLNAMDLDTSNLCE
YFKYSRNLKTLKEPDLRRQLLKYTKRDIVDCLCVLPKTRHDCDTFVVDMWLQTEKMLCFS
VNGVFKEIQGTSQGCVHAFTRTFIATPGSSTRLCIVNDHLFVRDARPDEIQSAFSIPVAT
PCSSSTSTLSQEHQRMAHAFSIQSGMKLQWAQK
Download sequence
Identical sequences 10141.ENSCPOP00000002841 ENSCPOP00000002841 ENSCPOP00000002841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]