SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002911 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002911
Domain Number 1 Region: 734-961
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-59
Family DBL homology domain (DH-domain) 0.000000000996
Further Details:      
 
Domain Number 2 Region: 331-507
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-57
Family Regulator of G-protein signaling, RGS 0.000000029
Further Details:      
 
Domain Number 3 Region: 966-1099
Classification Level Classification E-value
Superfamily PH domain-like 2.47e-42
Family Pleckstrin-homology domain (PH domain) 0.000000332
Further Details:      
 
Domain Number 4 Region: 29-121
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-21
Family PDZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002911   Gene: ENSCPOG00000003214   Transcript: ENSCPOT00000003257
Sequence length 1529
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:17470693:17525856:-1 gene:ENSCPOG00000003214 transcript:ENSCPOT00000003257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMLALPGQFSRLSSLSSLGDSAPERKSPSHHRQPSDTSETSGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGVSGLQQEPSGGAPRRITGPKPLQDPEVQKHATQILRNMLRQEEKELQRICEV
YSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDVLPLYGDVNQRPSEGHFSLESQEA
DSGLDSGTERFPSLSESLVNRNSVLSDPGLDSPRTSPVIMARLGQHHRRQGSDTSVLLTS
DQGVDPVPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSRPAHLAVFLRYIFSQADPSP
LLFYLCVEVYQQTNTKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDVRLRNGEDARS
VLCEAQEAAMPELQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPQRERQVAEKQLAALGE
ILSKYEEDRSAPMDFALNTYMSHTGIRLREARPSNTAEKAQSADKDKWLPFFPKTKKSSN
SKKEKDALEDKKRNPILKYIGKPKSSSQSTCHVALKKNSVKPGNVRNIIQHFENSQQYDA
PEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMKRSRKVENVPRSRSDVDMD
AAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIESPSLGFCTDALLPHLLEDD
LGQLSDLEPEPDAQNWQHTVGKDVVAGLNQREIDRQEVINELFVTEASHLRTLRVLDLIF
YQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKLREEGPIIKDISDLMLARFDGP
AREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQ
RLTKYPLLLENIIKHTQAGTSEHEKLCRARDQCREILKFVNEAVKQTENRHRLESYQKRL
DTTALERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQRQD
ERLLLKCHSKTAVGSADSKQTFSPVLKLNAVLIRSVATDKRAFFTICTSELGPPQIYELV
ALTSSDKNTWMELLEEAVRNTTRHPGTAPIPILPRPPGPQEPPHQGPTPSRMELDDSEVF
HGEAEPEELPEGPGTQQRVQGKQPVPPEEPEQRGSAEEEELEALPLAPTSLNGENRGIRT
RDLINLALPGPLFMEGLADSALEDVENLRHLILWSLLPGHTTDTRATAEPEDDLTPTPSV
VSITSHPWDPGSPGLAPIRGHKDNTQLPEPEEGQLQHEDMARSLAHLPPRTRNSGIWESP
ELDRNPPEEASSTEASGNYKVVRKAEVVGNKAVPALPESGQSEPEPPEVEGGTKATGTGN
CFYVSMPAGPVDSSTDPSGIATSHPQPQAGNGDQRLSSHSSSGLALRDVGMIFRTIEQLT
LKLNRLKDMELAHKELLKSFGGESSGGTTPVGNFHTDTSRWTDSSISPSTKEALACDPQD
SCEPESYPEDGCDTLLEDNTTDTPVSPGL
Download sequence
Identical sequences ENSCPOP00000002911 10141.ENSCPOP00000002911 ENSCPOP00000002911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]