SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003585 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003585
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.15e-73
Family BAR domain 0.0000000742
Further Details:      
 
Domain Number 2 Region: 269-329
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-21
Family SH3-domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003585   Gene: ENSCPOG00000003970   Transcript: ENSCPOT00000004014
Sequence length 332
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:32025906:32080342:-1 gene:ENSCPOG00000003970 transcript:ENSCPOT00000004014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLFSEKISGAEGTKLDDEFLDMERKIDVTNKAVAEILSKATEYLQPNPAYRAKLGMLNTV
SKIRGQVKTTGYPQTEGLLGDCMLKYGKELGDSTFGNALIEVGESLKLMAEVKDSLDINV
KQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKE
LAERSMFNFLENDVEQVSQLAVFVEAALDYHKQTTEILQDLQRKLQMRISAAASVLRREY
KPRPVKRSPSELNGVSSTSTAKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLT
NQIDENWYEGIIHGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences A0A286XJ82
ENSCPOP00000003585 10141.ENSCPOP00000003585 ENSCPOP00000003585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]