SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003587 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003587
Domain Number 1 Region: 1068-1146
Classification Level Classification E-value
Superfamily Immunoglobulin 7.27e-18
Family I set domains 0.0095
Further Details:      
 
Domain Number 2 Region: 681-754
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000394
Family I set domains 0.046
Further Details:      
 
Domain Number 3 Region: 464-517
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000379
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 969-1046
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000672
Family I set domains 0.038
Further Details:      
 
Domain Number 5 Region: 176-236
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000445
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 231-291
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 328-382
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 8 Region: 1238-1305
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000034
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 9 Region: 520-577
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000719
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 10 Region: 573-638
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000811
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 11 Region: 1187-1244
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000288
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 12 Region: 98-158
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000432
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 13 Region: 404-461
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000101
Family TSP-1 type 1 repeat 0.0098
Further Details:      
 
Domain Number 14 Region: 1363-1419
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000732
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003587   Gene: ENSCPOG00000003974   Transcript: ENSCPOT00000004018
Sequence length 1455
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:31689744:31847559:-1 gene:ENSCPOG00000003974 transcript:ENSCPOT00000004018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFNNPGVFVVENTTVEFQKGSE
RQTFKIAGPLMADFIFKTRYTVAKDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQLNS
AECVDIRLKRVVPDHYCHYYPENVKPKPKLKECGMDPCPSSDGFKEIMPYDHFQPLPRWE
HNPWTACSVSCGGGIQRRSFVCVEESMHAEILQVAEWKCMYAPKPKVMQTCNLFDCPKWV
AMEWSQCTVTCGRGLRYRVVLCINHLGEHVGGCNPQLKLHIKEECVIPTPCYKPKEKSPV
EAKLPWLKQAQELEETRIATEEPTFIPEPWSACSSTCGPGVQVRAVRCRVLLAFARTEAE
LPEDECEGPRPPTERPCLRQACPGSPEPREPDSRVPQEDSTGTFAWEYAGFTPCTATCLR
GRQETIAVCLHIQTQQTVNNSLCDAVHRPPAMSQACNTEPCPPRWHVGSWGPCSASCGVG
IQTREVHCLHPEESPAPPEKCGDGKPHALQACNQFDCPPAWHIEEWQQCTRTCGGGTQNR
RVTCRQLLTDGSFLNLPDELCQGPRASSHKSCARTDCPPQLVAGDWSKCSVSCGVGLQRR
KQVCQRLTAKGRRVTLSEAMCRDLPPLPLIRPCQAPVCSEMKEDTRTKAAEPGPQILSVQ
RVYIQTRVEKRINLTIGSRAYLLPNTSVIIKCPVRRFQRSLIRWEKDNQCLQNSKRLSIT
KSGSLKIHSLAAPDIGVYRCIAGSTQDTVVLKLIGTDNRLIAHPALRQHGKEPPGTDHPE
ANSLGATWHKMRQMWSNKNELSLPDGQFNNQPFLRALFGHCSNPAGSANSWELKNKQFEA
AIKQGAYSMDTVQFEELMRSMSQLMEAGKVSEELASQVIYQLVAELALAKVQPTPPQWRG
VQEEPLPSAPLRGQTGSVPQSKSAKGAGRLTFKPKGPVILRRSQPPSVSFNKTINARIGN
TIYITKRTEVIDIHCDLVTPSEVTYTWTKDGALLQPSVKISLDGTGRIQIRNPTRKEQGV
YECSVANHFGSDVESSSVLYAEAPVILSVERNITKPEHNHLSVVVGGIVEAAVGANVTIR
CPVKGVPQPTVTWLKRGRSLRDNVSLLFNGSLLLQNASLENEGTYICTGTNALGKAAAAF
TLHLLERRWPGSKAVFPKRHKKRVLQASNTRTNSSNNSRREPLPREPFWEPGNWTHCSAT
CGHLGTRIQRPHCVTATRQEVSAALCGHLQKPRAGFQPCNIRDCPARWFTSVWSECSVSC
GEGFHSRQVTCKQMKASGSVQMVSPRVCDPKDRPLGRRPCSGHPCTQWVIEAGNQCPGRC
LGHVVRTQQHHPACGQHNTSDPDCGDRSLPVLQRNCTSGACEVCWRTGPWRPCTAACGRG
FQSRKVDCLHVQSCKPVANSYCAPRKKPTSWRHCRGPSCDRDCTDTTHYCMFVKHLNLCS
LDLHKQRCCHSCQEG
Download sequence
Identical sequences 10141.ENSCPOP00000003587 ENSCPOP00000003587 ENSCPOP00000003587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]