SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004039 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004039
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.93e-68
Family Ephrin receptor ligand binding domain 0.00000211
Further Details:      
 
Domain Number 2 Region: 609-905
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.67e-65
Family Protein kinases, catalytic subunit 0.0000000426
Further Details:      
 
Domain Number 3 Region: 908-979
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.07e-16
Family SAM (sterile alpha motif) domain 0.00089
Further Details:      
 
Domain Number 4 Region: 302-501
Classification Level Classification E-value
Superfamily Fibronectin type III 7.38e-16
Family Fibronectin type III 0.00057
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004039
Domain Number - Region: 231-296
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000381
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004039   Gene: ENSCPOG00000004479   Transcript: ENSCPOT00000004528
Sequence length 984
Comment pep:known_by_projection scaffold:cavPor3:scaffold_25:15306:46524:1 gene:ENSCPOG00000004479 transcript:ENSCPOT00000004528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VILLDSKASQAELGWIALPSNGWEEISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWISR
GRGQRIFVELQFTLRDCSSIPGAAGTCKETFNVYYLETEADLGRGRLRLGGNRPRKIDTI
AADESFTQGDLGERKMKLNTEVREIGPLSRRGFHLAFQDVGACVALVSVRVYYKQCRATV
RGLAVFPATAAESAFSTLVEVAGTCVAHSEGDPGSPPRMHCGADGEWLVPVGRCSCSAGF
QERGDICEACPPGFYKVSPRRPLCSPCPEHSRALENASTFCVCQDSYARSPTDPPSASCT
RPPSAPRDLQYSLSRSPLALRLRWLPPADSGGRSDVTYSLLCLRCGREGPAGACEPCGPR
VAFVPRQAGAAGNAAVIFDVFLHAQNCFFLEAEQVGGRRREGHGEECFLRISLLQRQASA
PWEEDEIRRDRVEPQSVSLSWREPIPAGSLGANGTEYEIRYYEKGQSEHAYSMVKTGTPA
VTVTNLKPATRYVFQIRATSPGPSWESQSFNPSIEVQTPAKAQAEAFRCTSESRDQSPAV
VVTVVTISALLVLGSVMSVLAIWRSHRPCNYGKGGGDAHEEEELYFHFKVPTRRTFLDPQ
SCGDPLQAVHLFTKELDAKSITLERSLGAGRFGDLCCGCLQLPGRQELPVAVHTLRDGYS
DSQRLSFLAEALTLGQFDHSHIVRLEGVVTRGSPLMIVTEYMGLGALDSFLRHHEGQLVA
EQLLGLLPGLASAMKYLSEMGYVHRGLAARRVLVSSGLICKLSGFGRGPRDRAEAVYTTM
SGRSPALWAAPETLQFGHFSSASDVWSFGVVMWEVMAFGERPYWDMSGQDVIKAVEDGFR
LPPPRNCPSPLHRLMLDCWQKDPGERPRFTQIHSILSKMVQDPEPSKCATTACPRPPTPL
ADRAFSTFPSFGSVGAWLEALDLCRYKDSFTAAGYGSLEAVAEMTSQDLVHLGISSAEHR
EALLSGISALQARVLQLQGQGVQV
Download sequence
Identical sequences 10141.ENSCPOP00000004039 ENSCPOP00000004039 ENSCPOP00000004039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]