SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004049 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004049
Domain Number 1 Region: 145-458
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-98
Family Protein kinases, catalytic subunit 0.0000000000514
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-24
Family Pleckstrin-homology domain (PH domain) 0.000000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004049   Gene: ENSCPOG00000004489   Transcript: ENSCPOT00000004538
Sequence length 480
Comment pep:known_by_projection scaffold:cavPor3:scaffold_111:3865506:3879090:-1 gene:ENSCPOG00000004489 transcript:ENSCPOT00000004538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDMDQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEELMEF
QSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMECVDSERRPHFPQFSYSASGTA
Download sequence
Identical sequences A0A286XKS8
XP_003463160.1.53824 10141.ENSCPOP00000004049 ENSCPOP00000004049 ENSCPOP00000004049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]