SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004148 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004148
Domain Number 1 Region: 418-698
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.22e-77
Family Protein kinases, catalytic subunit 0.0000000476
Further Details:      
 
Domain Number 2 Region: 865-1006
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 9.29e-57
Family FAT domain of focal adhesion kinase 0.00000686
Further Details:      
 
Domain Number 3 Region: 138-256
Classification Level Classification E-value
Superfamily Second domain of FERM 8.37e-42
Family Second domain of FERM 0.0000206
Further Details:      
 
Domain Number 4 Region: 37-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.41e-33
Family First domain of FERM 0.00039
Further Details:      
 
Domain Number 5 Region: 261-365
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-30
Family Third domain of FERM 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004148   Gene: ENSCPOG00000004602   Transcript: ENSCPOT00000004651
Sequence length 1009
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:63289001:63339385:1 gene:ENSCPOG00000004602 transcript:ENSCPOT00000004651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVSEPLSRVKVATLRRPEAPPEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTIQTEIQEIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMETLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIKSIRCLPLEEGQAVLQLGIEGAPQSLSIKTSSPAEAENMADLIDGYCRLQGEHKG
SLIIHSKKDGEKRNSLPQVPMLNLEARRSYLSESCSIESDIYAEIPDETLRRPGGPQYGV
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKLNVAVKTCKKDCNLDNKEKFMSEGVMMQN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKSSLKVPTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVATPECVKLGDFGLSRYIEDEEYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVISVLEKGDRLPKPDLCPPILYTLMTR
CWDYDPSDRPRFTELVCSLSDIYQMEKDIAIEQERNTRYRTPKILEPAIYQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAEKLKMRQLLDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEAGYTEFTGPPQKPPRLCTQSIQPTANLDRTDDQVYFNVMELVRAVLDLKDELSQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Download sequence
Identical sequences H0V3I6
XP_003479418.1.53824 XP_005008178.1.53824 XP_005008179.1.53824 XP_012998892.1.53824 XP_012998893.1.53824 XP_012998894.1.53824 XP_012998895.1.53824 ENSCPOP00000004148 ENSCPOP00000004148 10141.ENSCPOP00000004148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]