SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004368 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004368
Domain Number 1 Region: 453-718
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-81
Family Protein kinases, catalytic subunit 0.0000224
Further Details:      
 
Domain Number 2 Region: 291-408
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-28
Family Pleckstrin-homology domain (PH domain) 0.0000177
Further Details:      
 
Domain Number 3 Region: 131-189
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.69e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 
Domain Number 4 Region: 7-65
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.49e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004368   Gene: ENSCPOG00000004855   Transcript: ENSCPOT00000004907
Sequence length 779
Comment pep:known_by_projection scaffold:cavPor3:scaffold_77:5484247:5554380:-1 gene:ENSCPOG00000004855 transcript:ENSCPOT00000004907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKI
PNNCSGVRRRRLSNVSLTGLSTVRTSSTELSTSAPDEPLLQKSPSESFIGREKRSNSQSY
IGRPIQLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQCKDCRFNCHKRC
APKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDMDEAMVQDAEMAM
AEGQNDSGEMQDGDPDQEDSNRTISPSTSNNIPLMRVVQSIKHTKRKSSSVMKEGWMVHY
TSKDTLRKRHYWRLDSKITLFQNDTGSRYYKEIPLSEILSLEAAKTSALIPNGANPHCFE
ITTTNVVYYVGEDVVSPSSPPPNNSVLTSGVGADVARRWELAIQHALMPVIPKGSSVSSG
STSHKDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGGKHRKTGRDVAIKI
IDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMILSS
EKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARI
IGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDIHDQI
QNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRELEC
KIGERYITHESDDLRWEQYAGEQGLQYPTHLINPSASHSDSPETEEREMKALSERVSIL
Download sequence
Identical sequences ENSCPOP00000004368 10141.ENSCPOP00000004368 ENSCPOP00000004368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]