SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004411 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004411
Domain Number 1 Region: 296-370
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000126
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 931-1019
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000549
Family Carboxypeptidase regulatory domain 0.021
Further Details:      
 
Domain Number 3 Region: 94-169
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000667
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 4 Region: 850-922
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000745
Family Rhamnogalacturonase B, RhgB, middle domain 0.037
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004411
Domain Number - Region: 409-459
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00102
Family Carboxypeptidase regulatory domain 0.018
Further Details:      
 
Domain Number - Region: 777-835
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00247
Family Cna protein B-type domain 0.0094
Further Details:      
 
Domain Number - Region: 182-265
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00726
Family Rhamnogalacturonase B, RhgB, middle domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004411   Gene: ENSCPOG00000004899   Transcript: ENSCPOT00000004952
Sequence length 1189
Comment pep:novel scaffold:cavPor3:scaffold_4:36870819:36925153:-1 gene:ENSCPOG00000004899 transcript:ENSCPOT00000004952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPLYDKTSLVLKKIE
PPLGWSFEPTNVELYVDGVSDICTKGGDINFVFTGFSVNGKVLSKGQLLGPAGVQVSLRN
TGTEAKIQSTVTQPGGKFAFFKVLPGDYEILATHPTWALKEASTTVRVTNSNANAASPLI
VAGYNVSGSVRSDGEPMKGVKFLLFSSLVTKEDVLGCNVSPVAGFQPQDESLVYLCYAVS
KEDGSFSFYSLPSGGYTVIPFYRGERITFDVAPSRLDFMVEHDSLRIEPVFHVMGFSVTG
RVLNGPEGEGVSEAVVTLNNQIKVRTKADGSFRLENITTGTYTIHAQKEHLYFETLTIKI
APNTPQLADIIATGFSVCGEVSITRFPDTAKQMNKYKVVLSSQDKDKSLVTVETDAHGSF
CFKAKPGTYKVQVVVPEAETRAGLMLKPQTFPLTVTDRPVMDVAFVQFLASVSGKVSCLD
TCGDLLVTLQSLSRQGEKRSLQLSGKVSSMTFTFDSVLPGKYKISIMHEDWCWKNKSLEV
EVLEDDVSAVEFRQTGYMLRCSLSHAITLEFYQDGNGPENVGIYNLSKGVNRFCLSKPGV
YKVTPRSCHRFEQAFYTYDTSSPSILTLTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPA
LVLGPLKSAQELRREQQLAEIETRRQEREKNGNEEGGEGRTKPPGQEMVDELQGPFSYDF
SYWARSGEKITVTPSSKELLFYPPSMEAVVSGESCPGKLIEIYGKAGLFLEGQIHPELEG
VEIVISEKGASSPLITVFTDDKGAYSVGPLHSNLEYTVTSQKEGYVLTAVEGTIGDFKAY
ALAGVSFEIKAEDDQPLPGVLLSLSGGMFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEF
RFEPSSQMIEVQEGQNLRITITGYRTAYSCYGTVSSLNGEPEQGVAVEAVGQKDCSIYGE
DTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDINIIVFRQ
INQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVL
LDSTLPRSQYDYVLPQVSFTAVGYHKHITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLA
GYNHDKLIPLLWQLTSRLQGVRALGQAASDNSGPEDAKRQAKKQKTRRT
Download sequence
Identical sequences 10141.ENSCPOP00000004411 ENSCPOP00000004411 ENSCPOP00000004411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]