SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004777 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004777
Domain Number 1 Region: 653-909
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.65e-59
Family Protein kinases, catalytic subunit 0.0000000621
Further Details:      
 
Domain Number 2 Region: 33-216
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.81e-56
Family Ephrin receptor ligand binding domain 0.00000445
Further Details:      
 
Domain Number 3 Region: 356-567
Classification Level Classification E-value
Superfamily Fibronectin type III 4.07e-33
Family Fibronectin type III 0.0000628
Further Details:      
 
Domain Number 4 Region: 933-1005
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.68e-17
Family SAM (sterile alpha motif) domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004777
Domain Number - Region: 286-359,395-416
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000466
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004777   Gene: ENSCPOG00000005313   Transcript: ENSCPOT00000005370
Sequence length 1007
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:5759605:5766910:1 gene:ENSCPOG00000005313 transcript:ENSCPOT00000005370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEGAASWRTRVVGMVCSLWALILGPSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVS
VLDDQSRLTRTFEACHVAAAPAGTTQDNWLQTHFVERRGAQRAHIRLHFSVRACASLGVS
GGTCRETFTLYYRQAEEPDSPDHIPAWHLKRWTKVDTIAADESFPAWAVGPHRTGQRAGL
QLNVKERSFGPLTQRGFYVAFQDTGACLALVAVKLFSYTCAPVLRAFASFPETQASGAGG
ASLVAAVGTCVAHAELEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCRCQAGHQPARGDK
TCQACPVGTYKASAGNAPCSPCPARSHAPDPAAPICPCLQGFYRASSDPPEVPCTGPPSA
PRELWFEVQGSLLMLHWRLPQELGGRGDLLFNVVCKECGGHQEPGSGGTCRRCRDEVHFD
PRQRGLTESRVLVGGLRAHVRYILEVQAVNGVTELSPDPPQAAAINVSTSHEVPSAVPVV
HQVSRAANSITVSWPQPDQANGNILDYQLRYYDQAEDESHSFTLTSETNTATVTRLSPGH
IYGFQVRARTAAGHGPYGSKVYFQTLPQGELSSPLPEKLSLVIGSILGALAFLLLAAITV
LAVIFQRKRRGTGYTEQLQQYSSPGIGVKYYIDPSTYEDPCQAIRELAREVDPAYIKIEE
VIGAGSFGEVRRGRLQPRGRREQAVAIQALWAGGAESLQMTFLGRAALLGQFQHPNILRL
EGVVTKSRPLMVLTELMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLANFAFVHR
ALSARSVLVNSHLVCKVARLGHSPQGSSCLLRWAAPEVIAHGKHTSSSDVWSFGILMWEV
MSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPALHLLMLDTWQKDHARRPHFDQLVAA
FDKMIRKPDTLQADGGSGDRPSQALLNPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGL
CTFSDVAQLSLEDLPALGITLAGHQKKLLYNIQLLQQHLRQPGSVEV
Download sequence
Identical sequences ENSCPOP00000004777 ENSCPOP00000004777 10141.ENSCPOP00000004777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]