SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005491 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005491
Domain Number 1 Region: 324-457,759-934
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.98e-53
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 57-179
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-29
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 3 Region: 1138-1204
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.29e-19
Family SAM (sterile alpha motif) domain 0.0039
Further Details:      
 
Domain Number 4 Region: 225-294
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.93e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000451
Further Details:      
 
Domain Number 5 Region: 165-221
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005491   Gene: ENSCPOG00000006087   Transcript: ENSCPOT00000006151
Sequence length 1212
Comment pep:known_by_projection scaffold:cavPor3:scaffold_6:52485294:52645995:1 gene:ENSCPOG00000006087 transcript:ENSCPOT00000006151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGSQHHPPGAAGGAASGAGSAGPGEDSSDSEVEQEGPQKLIRKVSTSGQLRTKTSIK
EGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEASTKNANNSFT
IITPFRRLMLCAENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYACSHARPTF
CNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIMEDEDGVAMPH
QWLEGNLPVSAKCAVCDKTCGSVLRLQDWRCLWCKTMVHTACKDLYHPVCPLGQCKVSII
PPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNG
GPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGTGNDLARVLG
WGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPEPPEAPEEFYMTIY
EDSVTTHLSKILNSDEHAVVLSSAKILCETIKDFVSKVEKTYDKTLENAVVAEAVATKCS
VLNEKLEQLLQAVHTDFQATPPLPGVGAVILEEDAVESSSEESLGESKDQLTEDITKPSS
QKGVKPREIMLRANSLKKAVRQVIEEAGKGIHQANKVMEEQTVIGTDYDSTETDESKEDS
RESLTGFLPTVKAAPRSPDAPASRGPSQTDSLPGPAVAATKENLPVLNTRIICPGLRAGL
AASIAGSSIINKMLLANVDPFGATPFIDPDLDSVDGYSEKCVMNNYFGIGLDAKISLEFN
NKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLPSLQGIAVL
NIPSYAGGTNFWGGTKEDDIFTAPSFDDKILEVVAIFDSMQMAVSRVIKLQHHRIAQCRT
VKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWEDKQKGDSG
KQVLRTHLYIQHAVDLATEEVSQMQLCSQAAEELITRICEAATIHCLLEQELAHAVNACS
HALNKANPRCPESLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEERVSSALHSV
EVELQKLTEIPWLYYILHPNENEEPPMDCTKRNNRSTVFRIVPKFKKDKVQKQKTSSQPV
QKWGTEEVAAWLDLLNLGEYKEIFIRHDIRGAELLHLERRDLKDLGIPKVGHVKRILQGI
KELGRSTAQAEV
Download sequence
Identical sequences ENSCPOP00000005491 ENSCPOP00000005491 10141.ENSCPOP00000005491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]