SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005868 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005868
Domain Number 1 Region: 30-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000128
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 111-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 71-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005868   Gene: ENSCPOG00000006516   Transcript: ENSCPOT00000006581
Sequence length 344
Comment pep:known_by_projection scaffold:cavPor3:scaffold_92:2786326:3037702:-1 gene:ENSCPOG00000006516 transcript:ENSCPOT00000006581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLGPLCLLLSSPAAESQLLPGNNFTNECNIPGNFMCGNGRCIPGSWQCDGLPDCFDKS
DEKECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYH
CRNGLCIDKSFLCDGQNNCQDNSDEEGCESSQEPGSGQVFVTSENQLVYYPSITYAIIGS
SIIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGI
QYVASQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGS
VDSASSRAASSLLSVEDTSTSPGQPDPLEGTAPPRDSVPSPGTE
Download sequence
Identical sequences ENSCPOP00000005868 ENSCPOP00000005868 10141.ENSCPOP00000005868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]