SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006091 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006091
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000905
Family Extracellular domain of cell surface receptors 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006091   Gene: ENSCPOG00000006760   Transcript: ENSCPOT00000006829
Sequence length 97
Comment pep:known_by_projection scaffold:cavPor3:scaffold_17:35033587:35034272:1 gene:ENSCPOG00000006760 transcript:ENSCPOT00000006829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMALWCYACHEPTSVSSCITITEYNANETLCKTILYTLEILYPFLGDSTVTKSCSSKCET
LDINGIGQTTSISCCNADLCNMDRALALGGTHSLALA
Download sequence
Identical sequences ENSCPOP00000006091 ENSCPOP00000006091 10141.ENSCPOP00000006091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]