SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006825 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006825
Domain Number 1 Region: 898-1190
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.44e-83
Family Complement components 0.000012
Further Details:      
 
Domain Number 2 Region: 1271-1400
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.09e-32
Family Alpha-macroglobulin receptor domain 0.0017
Further Details:      
 
Domain Number 3 Region: 744-789
Classification Level Classification E-value
Superfamily E set domains 0.00000476
Family SVA-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006825   Gene: ENSCPOG00000007568   Transcript: ENSCPOT00000007641
Sequence length 1437
Comment pep:known_by_projection scaffold:cavPor3:scaffold_4:46828575:46962330:1 gene:ENSCPOG00000007568 transcript:ENSCPOT00000007641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPQLLGELLLLCLGVAALAARPGGPSFLVTAPRTIRPGGNVTIGVELLEHSPSQITVK
AELLKKAANLTVSVLEAEGVFEKGSFKTLTLPSLPLNSKDESYELRVTGHAEDEILFYNS
TPLSFEIKRVSVVIQTDKLLYKPGQEVKFRVIMFSSDFRPYKASLDVFIKVSGKDKVSCW
LLQRSDHGVISKTFQLSSHPILGDWSIQVQINDQTYYQSFQVSEYVLPNFSFTPSTFFCT
VNSFHGPLSGKYTYGKPVKGDVTLTFLPLSFWGEKKNITKTFKINGSANFSFNDEEMKKV
MDFADGHSKHVDLSTPGPVEILATVTESLTGISRNASSNVFFKQHDYIIEFFDYATVLKP
SLNFTATVKVTRSDGSRLTQEERRNQVAIAVTQRNRTNLWSRWNHENEGMEDAHITNYTV
PPDGIFKIEFPVLDSSSQLQVKAYFLDSESNMEVHGTFTSPSKTYIQLKTRDENIKIGTL
FEYLISFTQKLNSSAFSFQVVSRGQLVAVGKQSSTTFSLTPENSWAPKACIIVYYVENDG
EIINDVLKIPVQLVFKNEVKLFWSKPNAEPSEKVSLRVAVTQPDSVVGIAAVDKSVSLMN
ASNDITMGNVVHELELYNTGYYLGMFMNSFTVFQECGLWVLTDAHLMKDYIDGVYDFVEY
AERYMEENEGYLDIHGFSSASNPHVRKHFPETWLWLDVHMGSKIYQEFEVTVPDSITSWV
ATAFVISEDLGLGLTTAPVELQAFQPNLPYSVIRGEEFALEVTIFNYLKDATEVKVIIEE
SDRFDILMTSKEINATGHQQDILVPSEDGTTVLFPIRPTHLGEIPITVRAISPMASDAIT
QRILVKAEGIEKSYSQAVLLDSTNRQPTVETLSFSFPPDTVSGSERVQITAVGDVLGPSI
HGLASLIRMPYGCGEQNMINFAPNIYILDYLTQKKQLTDNVKEKALSFMRQGYQRELLYQ
RDDGSFSAFGNSDPSGSTWLSAFVLRCFLEADPYIDIDPNVLHRTYNWLKGHQKSSGEFW
EPGRVIHSDLQGGNNSPVTLTAYIVTSLLGYRKYQPNIDVRDSISFLESKFSQGISDNYT
LALVTHALSSVGSPKAAEALRVLSLRAEEEGGERFWVSPASTLSEGWQPRSLDIEVAAYA
LLSHFLQRQAPQGLPVMRWLSRKRTSLGGFVSTQDTIVALKALSEFAVLMNTETKGIQVT
VSGPSAPRPVKFLIDTHNRFLFQTAELAVTQLAAVDITANGFGFAICQLNVVYNVKDSGS
VRRRRSTQNQEAFDLDVNVKDDENDVNHVNLNVCTRFLGPDRSGMALMEVNLLSGFAVPS
DTISLSETVKKVEYDHGKLNLYLDSVNETQFCVDIPAVRNFKVSNTQDASVSIVDYYEPR
RQAVRSYNSRVKLSSCDLCQDVQGHCPCEDGASDPHHPSSVLFVFSLVLLCSLQHWL
Download sequence
Identical sequences 10141.ENSCPOP00000006825 ENSCPOP00000006825 ENSCPOP00000006825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]