SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006944 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006944
Domain Number 1 Region: 93-212
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000828
Family PX domain 0.0037
Further Details:      
 
Domain Number 2 Region: 280-334
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000216
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 859-889
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000366
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006944   Gene: ENSCPOG00000007705   Transcript: ENSCPOT00000007779
Sequence length 913
Comment pep:known_by_projection scaffold:cavPor3:scaffold_434:118811:160074:-1 gene:ENSCPOG00000007705 transcript:ENSCPOT00000007779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLSGGGGGPGGKGAPGSTCPACHKMAPRAEPPVNS
VGNNSLEKALHTSAHSTEEPRRPLGKLGKVSVEKIDLKGLSHTKSDRNVECAFEVLWSDS
SVTSVTKSSSEVTEFISKLSQLCPEENLDKLIPCLAGPDPFYVERSHVDLEAGLRYLASL
PSHVLKNDHVKKFFSTSCPPQQLQSPGPGNPPLPKVGTVMGTSGRPVCGVAGIPSSQSST
QHHLPHVAGPGSALAYRAQVDPAPAILMPPGLQAPQPQEQNGILDWLRKLRLHKYYPVFK
QLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSERRCLNSTAPSLVTSSGVAR
VPPTSHVGPVQAGRSSHAAELRVEVEQPPHQVPREGGSSSEYSSSSSSPMGVQAREESSD
SAEESDRRVDVHLEGADKEKPVMLLSHFPSSSARPTAQVLPVQNEAGSSPASHHPLAPQL
LPATPHLAPMRMLSSVHKAERASSDVKLLSSSVHSILSLEERGKGPAARSGVKVDKGFGS
AVLDSLPAAVPHPPVQVLSGLSESSAVSPAVSFGPRAKVVHAATLDRVLKTAQQPALAVE
SSTAAAGTPSTVLHVARPPIKLLLSASVPADAASSGQTTCPNSVQISVAPAIINPRTALY
TANTKVAFSAVSSVPVGPLQGSFCANSNTASSSSHPAPSFASMATPPNYPAPSSSPALSS
IPESSFYSGSGGGGSPGTCPPRASSPGACIVCTSCGCSGSCGSGGLTVSYTNYFQHPFSG
PSVFTFPFLPFSPVCSNGYVSAQQYGGGSAFPVVHAPYSGSVTPDPVLGGQSSFAVPPMQ
NFVAGTAGVYQTQGLVGSSNGSSHKKSGNLSCYNCGATGHRAQDCKQPSMDFNRQGTFRL
KYAPPAESLDSTD
Download sequence
Identical sequences ENSCPOP00000006944 ENSCPOP00000006944 10141.ENSCPOP00000006944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]