SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007095 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007095
Domain Number 1 Region: 180-303
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.15e-59
Family Dystroglycan, domain 2 0.000000326
Further Details:      
 
Domain Number 2 Region: 495-596
Classification Level Classification E-value
Superfamily Cadherin-like 6.59e-19
Family Dystroglycan, N-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 61-159
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-18
Family Dystroglycan, N-terminal domain 0.00000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007095   Gene: ENSCPOG00000007882   Transcript: ENSCPOT00000007957
Sequence length 880
Comment pep:known_by_projection scaffold:cavPor3:scaffold_8:24605233:24622013:1 gene:ENSCPOG00000007882 transcript:ENSCPOT00000007957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRMFVGCWLLLPLWGKTLLLLSVATAQAHWPSEPSEATRHWESHLEASMHSVLSDLHEAV
PTVVGIPDGMAVIGRLFQVTIPTDLIASSGEIIKVSAAGKEALPSWLHWDPQSHTLEGLP
LDTDKGVHYISVSAARLGANGSHIPQTSSVFSIEVYPEDHSEPQSIRAASSDPSEIVSSA
CAADEPVTVLTVILDADLTKMTPKQRIDLLHRMQSFSEVEIHNMKLVPVVNNRLFDMSAF
MAGPGNAKKVVENGALLSWKLGCSLNQNNVPDIHGVEVPAREGAMSAQLGYPVVGWHIAN
KKPPLLKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIALPTETMVPPVRDP
VPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTVVPGQIRPTMTIPGYMEPTAVATPPI
TTTKKPRVSTPKPATPSTDSTTTTRRPTKKPRTPRPGPRVTTKAPITRLETASPPTRIRT
TTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKLRE
QQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGD
KASARFKAKFLGDPAPVVTDIHKKIALVKKLAFAFGDRNCSTITLQNITQGSILVEWTNN
TLPLEPCPKEQIIALSRKIAEDNGKPRPAFSNALEPDFKAMSIAVTGSGSCRHLQFIPVM
PPKRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGK
LTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPL
NQDTMGEYTPLRDEDPNMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences ENSCPOP00000007095 10141.ENSCPOP00000007095 ENSCPOP00000007095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]