SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008004 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008004
Domain Number 1 Region: 642-833
Classification Level Classification E-value
Superfamily Sec7 domain 4.06e-67
Family Sec7 domain 0.00000202
Further Details:      
 
Domain Number 2 Region: 407-588,1093-1494,1652-1759
Classification Level Classification E-value
Superfamily ARM repeat 8.75e-28
Family Clathrin adaptor core protein 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008004   Gene: ENSCPOG00000008910   Transcript: ENSCPOT00000008990
Sequence length 1788
Comment pep:known_by_projection scaffold:cavPor3:scaffold_45:14581096:14667151:1 gene:ENSCPOG00000008910 transcript:ENSCPOT00000008990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAEIEKQRLGAAAPPKA
NFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVE
TICNCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMEYQVLQEARELEKPIQSKPQSPVIQAAAVSPKFSHLKQSQAQS
KPTTPEKADLPNGEHARNDPGKASSENGDICRERGPSFSGMAELSRVGSDDGAQAVVKDI
LEDVVTSAVKEATEKHGLVEPNRLLGGLDCQECAVPPGIDENSQTNGIADDRQSLSSADN
LDSDAQGQQVAARFSHILQKDAFLVFRSLCKLSMKPLGEGPPDPKSHELRSKVVSLQLLL
SVLQNAGPVFRTHEMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHLKM
QIEVFFKEIFLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFER
LVNDLSKIAQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTSLG
QERLTDQEMGDGKGLDLARRSSVTSMESTVSSGTQTAIQDDPEQFEVIKQQKEIIEHGIE
LFNKKPKRGIQFLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGDSTRFNKEVMYAYV
DQLDFCEKEFVSALRAFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVL
AYSIIMLTTDLHSPQVKYEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIAMKETKEHT
IATKSTKQNVANEKQRRLLYNLEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKL
VWTPLLAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLERDAYVQALARFSLLTA
SSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKTRYLSG
SGREREGSLKGYTLAGEEFMGLGLSNLVSGGVDKRQMASFQESVGETSSQSVVVAVDRIF
TGSTRLDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSRIWH
VIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRS
PTIRDMVIRCIAQMVNSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTGHIVTSIF
QHHFPAAIDSFQDAVRCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPRVLQEYTSDDM
NVAPGDRVWVRGWFPILFELSRIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWQDLFR
IVFRIFDNMKLPEQQSEKSEWMTTTCNHALYAICDVFTQFYEALNEVLLSDVFAQLQWCV
KQDNEQLARSGTNCLENLVISNGEKFSPDVWGETCNCMLDIFKTTIPHVLLTWRPAGMEE
DSSEKHLDVDLDRQSLSSIDKNASERGQSQLSNPTDDSWKGRPYANQKLFASLLIKCVVQ
LELIQTIDNIVFYPATSKKEDAEHMVAAQQDTLDADIHIETEDQGMYKYMSSQHLFKLLD
CLQESHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMYVDENRK
DSWDEIQQRLLTVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKINDEKFKAHASMYY
PYLCEIMQFDLIPELRAVLRKFFLRIGVVYKIWIPEEPAQVPATLSPV
Download sequence
Identical sequences ENSCPOP00000008004 10141.ENSCPOP00000008004 ENSCPOP00000008004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]