SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008755 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008755
Domain Number 1 Region: 46-106,134-494
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.75e-85
Family Integrin alpha N-terminal domain 0.00000000191
Further Details:      
 
Domain Number 2 Region: 799-1015
Classification Level Classification E-value
Superfamily Integrin domains 1.31e-62
Family Integrin domains 0.00000888
Further Details:      
 
Domain Number 3 Region: 499-657
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-47
Family Integrin domains 0.0000136
Further Details:      
 
Domain Number 4 Region: 658-792
Classification Level Classification E-value
Superfamily Integrin domains 1.99e-36
Family Integrin domains 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008755   Gene: ENSCPOG00000009752   Transcript: ENSCPOT00000009840
Sequence length 1059
Comment pep:known_by_projection scaffold:cavPor3:scaffold_120:2971960:3140589:1 gene:ENSCPOG00000009752 transcript:ENSCPOT00000009840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRPPGRRAMSAGARRGPRGSRAQPLAPLWGFWAALGMLWSPASQAFNLDADEVTVYSGPE
GSYFGYAVDFHLPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAPCKQIPFDT
TIGSRLYNRKIRVNGTKEPIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKPSPEKDPV
GTCYVAIQNFSAYAEYSPCRNNNPDPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQV
ITASIADVIANYSFKDILRKLAGEKRTEVAPASYDDSYLGYSVAAGESQGKDAEKLVAGV
PRGAQNFGYVSIINSTDMTFIQNFTGEQMASYFGYTVVVSDVNNDGLDDLLVGAPLFMER
EFESSPREVGRVYLYLQVNALLFQDPQVLTGTEIFGRFGSAVVHLGDLNQDGYNADIAIG
VPFAGKDQRGKVLIYNGNQDGLNIRPSQTLHGVWASQTVPSGFGFALKGDSDIDKNDYPD
LLVGAFGAGKVTVYSRARPVVTVDAQLLLNPMIINLENKTCQIPESVTPVACFSLRVCAS
VTGQSIPNTIALVAELQLDSLKQKGAIKRTLFLNNRQSHLVFPLLVKRQKSFQCQNFIVY
LRDEIEFRDKLSPINISLNYSLDESTFKKGLEVKPILNHYRNNIITEQAHILVDCGEDNL
CVPDLKLWARPDKNQIIIGDENHLMLTINAKNEGEGAYEAELFVMIPEEADYVGIERNNK
GFRPVSCEYKMENVTRMVVCDLGNPMVTATNYSLGLRFAVPRLEKTNTSTNFDLQIRSSN
KDNPDSNFVSLQINITAVAQVEIRGVSHPQQVVLPIHNWEPEKEPHKEEEVGPLVEHIYE
LHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQTNPDINPQDIKLAPRTNF
KHLHQRTAPCSRFNSSNSPELMNCTNIECLQISCAVGRLERDESAVLKVRSRLWAHTFLQ
RKNNPYALASLVSFKVKKMPYRDQPAKLPEGGIAIKTSVIWATPNVSFSIPLWVIILAIL
LGLLVLAILTLALWKCGFFDRARPPQDDMADREQLTSDK
Download sequence
Identical sequences ENSCPOP00000008755 ENSCPOP00000008755 10141.ENSCPOP00000008755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]