SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009420 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009420
Domain Number 1 Region: 741-1030
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000742
Family Rhodopsin-like 0.034
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009420
Domain Number - Region: 43-259
Classification Level Classification E-value
Superfamily YWTD domain 0.00259
Family YWTD domain 0.025
Further Details:      
 
Domain Number - Region: 377-421
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0183
Family Hormone receptor domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009420   Gene: ENSCPOG00000010490   Transcript: ENSCPOT00000010585
Sequence length 1279
Comment pep:known_by_projection scaffold:cavPor3:scaffold_24:31521826:31794457:1 gene:ENSCPOG00000010490 transcript:ENSCPOT00000010585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDV
IAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHD
TSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAYDKRSAS
NAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSLVDVPFPNSYQYIAAVDYNP
RDNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIHLDSETRKTPMRGVSTPG
PLGMGSTTTSATLRTTPWGAGRSTTPSGSGRRNRSTSTPSPALELPGDVTTHLPSAASQA
PALEESCEAVEAREIMWFKTRQGQVAKQPCPAGTIGVSTYLCLAPDGNWDPQGPDLSNCS
SLWVNHITQKLVSSLAMLIIIREFAKKEENHIKSRDFIWVLLWCDSLIKIEDIFKTNDCS
TQKSQSREPISKLQKRERSCRAYVQAMVETVNNLLQPQALNAWRDLTTSDQLRAATMLLD
TVEESAFVLADNLLKTDIVRENTDNIQLEVARLSTEGNLEDLKFPENMAHGSTIQLSANT
LKQNGRNGREIRVAFVLYNNLGPYLSTENASMKLGTEALSTNHSVIVNSPVITAAINKEF
SNKVYLADPVVFTVKHIKQSEENFNPNCSFWSYSKRTMTGYWSTQGCRLLTTNKTHTTCS
CNHLTNFAVLMAHVEVKHSDAVHDLLLDVITWVGILLSLVCLLICIFTFCFFRGLQSDRN
TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLV
EVFESEHSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATL
IIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTW
AFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEFGKCLRTHCCSGKSTES
SIGSGKTSGSRTPGRYSTGSQSRIRRMWNDTVRKQSESSFITGDINSSASLNRGAMANHL
ISNALLRPHGTNNPYNTLLGEPAVCNNPSVSMYNAQEGLLNNARDTSVMDTLPLNGNHGN
SYSIAGGEYLSNCVQIIDRGYTHNETALEKKILKELTSNYIPSYLNNHERSSEQNRNLMN
KLVNNLGGGGEDDSIVLDDATSFTHEEGLGLELIHEESDAPLLPPRVYPAENHQPHHFSR
RRLPQDHSESFFPLLSNEH
Download sequence
Identical sequences ENSCPOP00000009420 10141.ENSCPOP00000009420 ENSCPOP00000009420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]