SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009632 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009632
Domain Number 1 Region: 12-120,318-397
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.86e-28
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0086
Further Details:      
 
Domain Number 2 Region: 148-181,269-360
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000000000866
Family Siroheme synthase N-terminal domain-like 0.042
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009632
Domain Number - Region: 129-232
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00161
Family FAD/NAD-linked reductases, N-terminal and central domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009632   Gene: ENSCPOG00000010730   Transcript: ENSCPOT00000010828
Sequence length 505
Comment pep:known_by_projection scaffold:cavPor3:scaffold_28:14869338:14888384:1 gene:ENSCPOG00000010730 transcript:ENSCPOT00000010828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEAAHQRQTMGKFVVVGGGIAGVTCAEENKLAVSFPSEEILLITASPVIKAVTNFKQVSK
ILEEFDVEEQPSTMLESRFPNIKVIESGLKQLKSKEHCIVTEDGNQHVYEKLCLCAGAKP
KLICEGNPYVLGIRDTDSAQEFQKQLTKAKRIMIIGNGGIALELVYEIEGCEVIWAIKDK
AIGNTFFDAGAAEFLTSKLVSEKPEAKIPHKRTKYTTEGMKKEARSKAKADNVGSALGPD
WHEGLDLKGTEETFLHHKVHIEPMCEVKKIYLQEEFRLLKKNSLTFPTNHNKSVTTDNET
WPVYVELTNEKLYGCDFIVSATGVTPNTELFLHGNNFDVGEDGGLKVDDHMHTSLPDIYA
AGDICTAAWQPSPVWQQMRLWTQARQMGWYAAKCMTAARLGNCIDMDFSFELFAHVTKFF
NFKVVLLGKYNAQGLGSDHELMLRCTKGQEYVKVVMQNGRMMGAVLIGETDLEETFENLI
LNQMDLSPYGEELLDPNIDIEDYFD
Download sequence
Identical sequences ENSCPOP00000009632 10141.ENSCPOP00000009632 ENSCPOP00000009632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]