SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009897 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009897
Domain Number 1 Region: 40-342
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.18e-56
Family Asparaginyl hydroxylase-like 0.068
Further Details:      
 
Domain Number 2 Region: 1051-1283
Classification Level Classification E-value
Superfamily RNI-like 5.89e-29
Family Cyclin A/CDK2-associated p19, Skp2 0.024
Further Details:      
 
Domain Number 3 Region: 625-703
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000293
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009897   Gene: ENSCPOG00000011011   Transcript: ENSCPOT00000011112
Sequence length 1306
Comment pep:known_by_projection scaffold:cavPor3:scaffold_115:1551797:1646465:1 gene:ENSCPOG00000011011 transcript:ENSCPOT00000011112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEKDSGRRLRPIDRQRYDENEDLSDVEEIVSVRGFSLEEKLRSQLYQGDFVHAMEGKD
FNYEYVQREALRVPLVFREKDGLGIKMPDPDFTVRDVKLLVGSRRLVDVMDVNTQKGTEM
SMSQFVRYYETPEAQRDKLYNVISLEFSHTKLEHLVKRPTVVDLVDWVDNMWPQHLKEKQ
TEATNAIAEMKYPKVKKYCLMSVKGCFTDFHIDFGGTSVWYHVFRGGKIFWLIPPTLHNL
ALYEEWVLSGKQSDIFLGDRVERCQRIELKQGYTFFIPSGWIHAVYTPVDSLVFGGNILH
SFNVPMQLRIYEIEDRTRVQPKFRYPFYYEMCWYVLERYVYCVTQRSYLTQEYQRESMLI
DAPRKASVDGFSSDSWLEMEEESCEQQPQEEEEEEKEAVEGAQRTPKACTEGPASPGATA
SEEQETPPGKKPRAPAARFLKRTLSNESEDSVKSATAPGDCPKTPTGSPAAEVAAKWTHL
TEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVKNVLKEHAEDDPSLAITGVPV
VSWPKKTPKNRAVGRPKGKPGPASAVKLATNRTTAGARRRRTRCRKCEACLRTECGECHF
CKDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLMECS
ICNEIIHPGCLKIKESEGVVNDELPNCWECPKCNHAGKTGKQKRGPGFKYASNLPGSLLK
EQKMNRDNKEGPEPAKRRSECEEAPRRRSDEHPKKVPADSILRRKSDDVHLRRKRKYEKP
QELSARKRASTLQTSPGSSHLSPRPPLGSSLSPWWRSSLTYFQQQLKPGKEDKLFRKKRR
SWKNAEDRMPLATKPLRRFKQEPEDDVPEVPPKSRDSDHSRSSSPTAGPSTEGTEGSEEK
KKVKIRRKRRLPSKELSKELSKELNHEIQKTESSLAHENHQPIKSEPESENEEPRRPLGL
CERPHRFSKGLNGTPRELRQPLGPSLRSPPRVLSRPPPATSPPKCIQMERHVIRPPPISP
PPDSLPLDDGAAHVMHREVWMAVFSYLSHRDLCVCMRVCRTWNRWCCDKRLWTRIDLNHC
KSITPLMLSGIIRRQPVSLDLSWTNISKKQLSWLINRLPGLRDLVLAGCSWIAVSALCSS
NCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIMELRLAGLDITDASL
RLIIRHMPLLSKLHLSYCNHVTDQSINLLTAVGTTTRDSLTEITLSDCNKVTDQCLSFFK
RCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKLS
Download sequence
Identical sequences A0A286XPM5
XP_003462973.1.53824 ENSCPOP00000009897 10141.ENSCPOP00000009897 ENSCPOP00000009897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]