SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010642 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010642
Domain Number 1 Region: 147-461
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-99
Family Protein kinases, catalytic subunit 0.0000000000216
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-25
Family Pleckstrin-homology domain (PH domain) 0.000000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010642   Gene: ENSCPOG00000011831   Transcript: ENSCPOT00000011946
Sequence length 481
Comment pep:known_by_projection scaffold:cavPor3:scaffold_157:315958:345968:-1 gene:ENSCPOG00000011831 transcript:ENSCPOT00000011946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRVPGEDPM
DYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTNDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPGDAKEVMEHGFFLSISWQDVVQK
KLQPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
Download sequence
Identical sequences A0A286Y1G4
ENSCPOP00000010642 ENSCPOP00000010642 XP_003462041.1.53824 XP_005000006.1.53824 XP_005000010.1.53824 XP_005000011.1.53824 XP_013014609.1.53824 XP_013014614.1.53824 XP_013014616.1.53824 XP_013014625.1.53824 10141.ENSCPOP00000010642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]