SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011019 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011019
Domain Number 1 Region: 482-821
Classification Level Classification E-value
Superfamily Folate-binding domain 5.65e-88
Family Aminomethyltransferase folate-binding domain 0.0000199
Further Details:      
 
Domain Number 2 Region: 69-289,389-474
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-57
Family FAD-linked reductases, N-terminal domain 0.0000778
Further Details:      
 
Domain Number 3 Region: 289-388
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.42e-29
Family L-aminoacid/polyamine oxidase 0.0082
Further Details:      
 
Domain Number 4 Region: 823-917
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0000000000000018
Family Aminomethyltransferase beta-barrel domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011019   Gene: ENSCPOG00000012251   Transcript: ENSCPOT00000012367
Sequence length 919
Comment pep:known_by_projection scaffold:cavPor3:scaffold_18:39485682:39522628:-1 gene:ENSCPOG00000012251 transcript:ENSCPOT00000012367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSRALHLAATCPRWRLAPRLGLQALASTVNPPAEKNVPYQRTLKEEAVGPLAETRGP
SQPLPNTASVVVIGGGSLGCQTLYHLAKLGVTGAVLLERERLTSGTTWHTAGLLWQLRPS
DVEVELLAHTRRVVSRELEEETGLHTGWIQNGGLFIASSRQRLDEYKRLMSLGKAYGVES
HVLSPAETKALYPLMNVDDLYGTLYVPQDGTMDPAGTCTALARAATARGAKVIERCPVTG
IRVQTDDFGVRRVTAVETEHGSIQTPCVVNCAGVWAGAVGRMAGVKVPLVAMHHAYVVTE
RIEGIQNMPNVRDHDTSVYLRLQGDALSVGGYETNPIFWEEVSDKFAFGLFDLDWDVFTQ
HIEGAINRVPVLETTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGG
CGQELAHWVVYGRPEKDMYSYDIRRFPHSLTEHSRWIRERSHESYAKNYAVVFPHDEPLA
GRNMRRGPLHEELLGRGCVFQERHGWERPGWFSPQGPAPVLEYDYYGAYGKRPHQDYAYG
RLLGDEYTFDFPPHHHLIQEECLACRGAAAVFDMSYFGKFYLLGPDAAKAADWLFSADVR
RPPGSTVYTCMLNHRGGTESDLTVSRLAPGTQGCPVAPTFEGDGYYLAVGGAVAQHNWCH
ITTVLQDQQFQCQLIDCSEDLGLISIQGPASRAILQEVLDTDLSDAAFPFSSHQLVQAAG
HLVRALRLSFVGELGWELHVPRASCVPVYRALMTAGAKHGLVNAGYRAIDSLSIEKGYRH
WHADLRSDDSPLEAGLAFTCKLKSAVPFLGREALEQQRASGLRRRLVCLTVEEKVPMFGL
EAIWRDGQVVGHVRRADFGFTVDKTIAYGYICDPSGRPVSLDFVKSGDYALERMGVSYAA
QVHLKSPFDPDNKRVKGIY
Download sequence
Identical sequences H0VL05
XP_003473190.1.53824 XP_013011429.1.53824 ENSCPOP00000011019 ENSCPOP00000011019 10141.ENSCPOP00000011019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]