SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011243 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011243
Domain Number 1 Region: 15-124
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-21
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000011243
Domain Number - Region: 218-301
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.0241
Family Platelet-derived growth factor-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011243   Gene: ENSCPOG00000012495   Transcript: ENSCPOT00000012614
Sequence length 307
Comment pep:known_by_projection scaffold:cavPor3:scaffold_7:33260503:33342980:1 gene:ENSCPOG00000012495 transcript:ENSCPOT00000012614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVQNPQHERVITVATNGSIHSPRFPHAYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDP
EDDICKYDFVEVEEPSDGSVLGRWCGSGAAPGKQISKGNQIRIRFVSDEYFPAEPGFCIH
YSIVAPQVTEAVSPSMLPPSALPLDLLNNAVTAFSTLEDLIRYLEPERWQLDLEDLYRPS
WQLLGKAFVFGRKSKVMYVLGLVTEEILLRIAVPRKFSVWKIAMDLQKNKVQCFQDCILR
KYCRGIAGGSLGNCRHCTRKIFKKYKEVLQLRPKTGIRGLHKSLTDIALEHHEECGCVCR
GHSHSGG
Download sequence
Identical sequences ENSCPOP00000011243 10141.ENSCPOP00000011243 ENSCPOP00000011243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]