SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012257 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012257
Domain Number 1 Region: 778-959
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.85e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0034
Further Details:      
 
Domain Number 2 Region: 934-1053
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0052
Further Details:      
 
Domain Number 3 Region: 158-192,235-381
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-31
Family Phosphotyrosine-binding domain (PTB) 0.0055
Further Details:      
 
Domain Number 4 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-20
Family Phosphotyrosine-binding domain (PTB) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012257   Gene: ENSCPOG00000013615   Transcript: ENSCPOT00000013751
Sequence length 1173
Comment pep:known_by_projection scaffold:cavPor3:scaffold_24:12453740:12661974:1 gene:ENSCPOG00000013615 transcript:ENSCPOT00000013751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPFPSEVSINFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSGQSSKKEPV
VRPVRLWVSPSGLRCEPDPGRSQQWDPLICSSIFECKPQRVHKLIHNSHDPSYFACLIKE
DAAHRQSICYVFKADDQTKVPEIISSIRQAGKIARQEELRCPSEFDDTFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHISSSLRADGEPASRGPEPPVDRVPSPGAARRRPMRKSQ
SQPGLRSLAYRREFQDGGLRSSSFFSSFEENDIENHLISGHHIVQPTDIEENRTMLFTIG
QSEVYLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICREALGGGGFHFVCYVFQCAN
EALVDEIMMTLKQAFTVAAVQQTAKAPAQLCEACPLQGLHKLCERIEAGMNSSKTKLELQ
KHLTTLTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHIHIGEMKQTPQI
AAENIGSELPASAPRFRLDMLKNKAKRSLTESLESILSRGSKARGLQEHSASVDLDSSVS
STLSSTSKEPSTGDKEALPVSESSFKLLGSSDDLSSDSESHPLEEPAPLSPQQAFRRRAN
TLSHFPVQCPAPPEPAQGSPGVIQRKLMRYHSVSTETPHERKDFESKADHLEDVGETPVK
TRRHSWRQQIFLRVATPQKASDSPGRFEDYSELGELPPRSPLEPVCEDGPFGPVPEEKKR
TPRELRELWRKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWE
KMLSFPGRSKTKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHPFPSKQQPKDVPYK
ELLKQLTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSF
VAGILLLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYDHL
EEHEIGPSLYAAPWFLTVFASQFPLGFVARVFDMIFLQGSEVIFKVALSLLGSHKPLILQ
HENLETIVDFIKNTLPNLGLVQMEKTINQVFEMDIAKQLQAYEVEYHVLQEELIDSSPLS
DNQRMDKLEKTNSSLRKQNLDLLEQLQVAHSKIQSLEATVEKLLTNENKLKQAVLTLEGE
RTALLEMVEKLRRRPEELSAGQPDHSQHEPTGD
Download sequence
Identical sequences 10141.ENSCPOP00000012257 ENSCPOP00000012257 ENSCPOP00000012257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]