SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012971 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012971
Domain Number 1 Region: 245-554
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.29e-116
Family Transglutaminase core 0.0000000182
Further Details:      
 
Domain Number 2 Region: 86-240
Classification Level Classification E-value
Superfamily E set domains 2.66e-45
Family Transglutaminase N-terminal domain 0.00013
Further Details:      
 
Domain Number 3 Region: 680-779
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.11e-29
Family Transglutaminase, two C-terminal domains 0.00056
Further Details:      
 
Domain Number 4 Region: 568-679
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.33e-28
Family Transglutaminase, two C-terminal domains 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012971   Gene: ENSCPOG00000014400   Transcript: ENSCPOT00000014545
Sequence length 807
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:16530689:16543210:1 gene:ENSCPOG00000014400 transcript:ENSCPOT00000014545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMMDGPRSDMGRWGGNPLQPPTTPSPEPQHRSRRGGARSFWARCCGCCSCRNREDDDWGP
EPSGSRGSRNRGSRNRRPESRGSGVNAAGDGTIREGMLVVTGVDLLSSRSDQNRREHHTD
EFEYDELIVRRGQPFQLVLFLNRPYESSDRIALELLIGNNPEVGKGTHVIIPVDKGGSGG
WKAHVTKASGQNLNLRVHTSPSAIIGKFQFTVRTRCEAGEFQLPFDPQNEIYILFNPWCP
GDTEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRRG
MPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTG
YSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNH
DSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMKY
DTPFIFAEVNSDKVYWQRQEDGSFKIVYVEEKAIGTLIVTKAISSNMREDITHIYKHPEG
SEAERKAVETAAAHGSKPNVYATRDSAEDVAMQVEAQDAVTGQDLTVSVVLTNRGSSQRT
VKLHLYLSVTYYTGVTGSIFKESKKEVALAPGASDQVTMPVAYKEYRPHLVDQGAMLLNV
SGHVKESGQVLAKQHTFRVRTPDLSLTLLGAAVVGQECEVQIIFKNPLPITLTSVVFRLE
GSGLQRPKVLNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPA
SGGRFFSEAGGDSRSGESIPMASRGGA
Download sequence
Identical sequences ENSCPOP00000012971 ENSCPOP00000012971 10141.ENSCPOP00000012971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]