SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012993 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012993
Domain Number 1 Region: 1033-1127
Classification Level Classification E-value
Superfamily Immunoglobulin 7.24e-23
Family I set domains 0.0032
Further Details:      
 
Domain Number 2 Region: 745-838
Classification Level Classification E-value
Superfamily Immunoglobulin 7.97e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 841-935
Classification Level Classification E-value
Superfamily Immunoglobulin 6.43e-21
Family I set domains 0.0061
Further Details:      
 
Domain Number 4 Region: 937-1031
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-20
Family I set domains 0.0022
Further Details:      
 
Domain Number 5 Region: 1129-1216
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-19
Family I set domains 0.0064
Further Details:      
 
Domain Number 6 Region: 96-190
Classification Level Classification E-value
Superfamily Immunoglobulin 3.65e-18
Family I set domains 0.0079
Further Details:      
 
Domain Number 7 Region: 652-742
Classification Level Classification E-value
Superfamily Immunoglobulin 4.31e-16
Family I set domains 0.0053
Further Details:      
 
Domain Number 8 Region: 191-285
Classification Level Classification E-value
Superfamily Immunoglobulin 6.46e-16
Family I set domains 0.0048
Further Details:      
 
Domain Number 9 Region: 287-383
Classification Level Classification E-value
Superfamily Immunoglobulin 7.53e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 10 Region: 3-92
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000179
Family I set domains 0.0089
Further Details:      
 
Domain Number 11 Region: 558-649
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000141
Family I set domains 0.0034
Further Details:      
 
Domain Number 12 Region: 387-473
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000658
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012993   Gene: ENSCPOG00000014426   Transcript: ENSCPOT00000014571
Sequence length 1305
Comment pep:known_by_projection scaffold:cavPor3:scaffold_191:732162:744226:-1 gene:ENSCPOG00000014426 transcript:ENSCPOT00000014571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQPELWIESNYPQAPWENITLWCRSPSRISSKFLLLKDKTQMTWIRPSYKTFQASFLL
GALTESNTGFYRCCYWKETGWSKPSKILELEAPGQLPKPIFWIQAETPPLLGCNVNVLCH
GWLQDLVFMLFKEGYAEPVDYQVPTGRVAIFSIDNMTPEKEGVYICRTHIQMLPTLWSEP
SNPLKLVVAGLYPKPTLTAYPGPIMAPGESLSLRCQGPIYGMTFALMRLEDMEKSFYHKE
PIKNEAYFFFPTLKIHDSGRYLCFYYDGSYRGSLLSDILKIWVTDALPKTWLLARPSPVV
LMGQNISLKCRGSVDGVGLALYKKGEDKPVQFLDATSVIDNKPFLLHGVTHHDAGIYSCN
YHLTWKTSIRMVTHNTVELLVVGKYKPPKHCLSAWPSTVFKQAKAITLQCPVSHPVLEFF
LEWEERATFHKFLEDGDFIITNIEGKRTGTYSCSYHVEVHPNVWSHCSEPLKLIGPAGFL
TWNSILDEAIRLSLMTELAALLLVLLWIRWKCRRLRIREAWLLETAQGVTMLFIVAALLC
CGLCNGVLTEETEIIMPTPKPELWAETNFPLAPWENLTLWCRSPSGSTKEFVLLKDGTGW
IATRRASEQVRAAFPLGELTQSHRGSYHCHSWEEMAVSEPSEALELVGTDILPKPVISAS
PPIRGQELQIRCKGWLAGMEFALYRDGEQEPVQQLGAVGREAFFIIRRMEDKDEGNYSCR
THTATLPFKWSEPSEPLELVIKEMYPKPFFKTLGSPQVTLGARVTFNCSTPHQHMSFILY
KDDNEIASSDRSWANPGPSSAHFLIVSVGIGDGGNYSCRYYDFDTWSEPSDPVELVVTEF
YPKPILLAQPGPVVFPGKDVTLHCQGNLKGMRFALLREGTKAPLQFQSAAGSSADFLLHT
VGAEDSGNYSCIYYETTMSNRGSYLSTPLMIWVTDTFPKPWLFAEPSSVVSMGQNVTLWC
QGPFHGVGYILHKEGEATSRQLWGSTSNDGAFPITSVSDANIGRYSCCYHPDWTSSIRIQ
PSNTLELMVTGLLPKPILLAHPGPMVVPGENMTLQCQGELPDSTFFLLKEGIQAPLEHQR
PIGYRADFWMPVVRSEDSGIYSCVYYLDSAPLAASYPSTSLEIWVTDKPPKPSLSAWPNT
VFKLGKDITLQCRGPLPGVEFVLEHDGEEAPQQFSENGDFVINNVEGKGIGNYSCSYRLQ
ASPDIWSEPSDSLELVGAAGPAAQECTVGNIVRSSLIVVVVVALGVVLAIEWKKWPRLRT
RGSETDGRDQTIVLEECNQEGEPGTTTNSPSSTSQGISVELPVPI
Download sequence
Identical sequences 10141.ENSCPOP00000012993 ENSCPOP00000012993 ENSCPOP00000012993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]