SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013105 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013105
Domain Number 1 Region: 835-1163
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-85
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000438
Further Details:      
 
Domain Number 2 Region: 1126-1423
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.07e-80
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000168
Further Details:      
 
Domain Number 3 Region: 3-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-37
Family MAM domain 0.000000575
Further Details:      
 
Domain Number 4 Region: 363-557
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-27
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 260-400
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000257
Family Fibronectin type III 0.0062
Further Details:      
 
Domain Number 6 Region: 165-268
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000235
Family I set domains 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013105   Gene: ENSCPOG00000014543   Transcript: ENSCPOT00000014688
Sequence length 1424
Comment pep:known_by_projection scaffold:cavPor3:scaffold_45:8460076:9218561:-1 gene:ENSCPOG00000014543 transcript:ENSCPOT00000014688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGGCSFDEHYSNCGYSVALGTNGFTWEQINTWEKPMLDPAVPTGSFMMVNSSGRASGQK
AHLLLPTLKENDTHCIDFHYYFSSRDRSSPGALNVYVKVNGGPQGNPVWNVSGVVTEGWV
KAELAISTFWPHYYQVIFESVSLKGHPGYIAVDEVRVLAHPCRKAPHFLRLQNVEVNVGQ
NATFQCIAGGKWSQHDKLWLQQWNGRDTALMVTRVVNHRRFSATVSVADTAQRSVSKYRC
VIRSDGGSGVSNYAELIVKEPPTPIAPPELLAVGATYLWIKPNANSIIGDGPIILKEVEY
RTTTGTWAETHIVDSPNYKLWHLDPDVEYEIRVLLTRPGEGGTGPPGPPLTTRTKCADPV
HGPQNVEIVDIRARQLTLQWEPFGYAVTRCHSYNLTVQYQYVFNQQQYEAEEVIQTSSHY
TLRGLRPFMTIRLRLLLSNPEGRMESEELVVQTEEDVPGAVPLESIQGGPFEEKIYIQWK
PPNETNGVITLYEINYKAVGSLDPSADLSSQRGKVFKLRNETHHLFVGLYPGTTYSFTIK
ASTAKGFGPPVTTRIATKISAPSMPEYDTDAPLNETDTTITVMLKPAQSRGAPVSVYQLV
VKEERLQKSRRAADIIECFSVPVSYRNASSLDSLHYFAAELKPANLPVTQPFTVGDNKTY
NGYWNPPLSPLKSYSIYFQALSKANGETKINCVRLATKGASTQNSNTMEPEKQVDNTVKM
AGVIAGLLMFIIILLGVMLTIKRRKLAKKQKETQSGAQREMGPVASADKPTTKLSSNRND
EGFSSSSQDANGFTDGSRGELSQPTLTIQTHPYRTCDPVEMSYPRDQFQPAIRVADLLQH
ITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISCRYSPRRAQASSFQ
WRLSLCFPSVIQGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRHPA
EHTMGNATLGRAASPGMVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYH
EIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAI
DTMLDMAENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLCGNTAIPVCEFR
SLYYNISRLDPQTNSSQIKDEFQTLNIVTPRVRPEDCSIGLLPRNHDKNRSMDVLPLDRC
LPFLISVDGESSNYINAALMDSHKQPAAFVVTQHPLPNTVADFWRLVFDYNCSSVVMLNE
MDTAQLCMQYWPEKTSGCYGPIQVEFVSADIDEDIIHRIFRICNMARPQDGYRIVQHLQY
IGWPAYRDTPPSKRSLLKVVRRLEKWQEQYDGREGRTVVHCLNGGGRSGTFCAICSVCEM
IQQQNIIDVFHIVKTLRNNKSNMVETLEQYKFVYEVALEYLSSF
Download sequence
Identical sequences 10141.ENSCPOP00000013105 ENSCPOP00000013105 ENSCPOP00000013105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]