SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013433 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013433
Domain Number 1 Region: 660-855
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-76
Family Sec7 domain 0.00000156
Further Details:      
 
Domain Number 2 Region: 417-600,1113-1125,1159-1503
Classification Level Classification E-value
Superfamily ARM repeat 9.98e-27
Family HspBP1 domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013433   Gene: ENSCPOG00000014908   Transcript: ENSCPOT00000015053
Sequence length 1819
Comment pep:known_by_projection scaffold:cavPor3:scaffold_0:45196865:45289523:1 gene:ENSCPOG00000014908 transcript:ENSCPOT00000015053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQLRGVPNISTEEIKAETEKQSPPHGEAKAGSSTLPPVKSKTNFIEADKYFLPFELACQS
KCPRIVSTSLDCLQKLIAYGHLTGNAPDSTTPGKKLIDRIIETICGCFQGPQTDEGVQLQ
IIKTVTVVIECLYIRIHLRAVIALYLNCFNVIYLLHKNLPSQCVTVATNSPQYEFLFVYI
KNPSLQEAKQMEKERHRQHHHHLLQSPVSHHEPESPQLRYLPPQTVDHLSQEQGDLDPHT
NDVDKSLQDDTEPENGSDISSAENEQTEADQATSAETLSKNDILYDGENHDYEEKPQDIV
QSIVEEMVNIVVGDMGEGTPINASTDGNLGTIEDGSDSENIQANGIPGTPISVAYTPSLP
DDRLSVSSNDTQESGNSSGPSPGAKFSHILQKDAFLVFRSLCKLSMKPLSDGPPDPKSHE
LRSKILSLQLLLSILQNAGPVFRTNEMFINAIKQYLCVALSKNGVSSVPEVFELSLSIFL
TLLSNFKTHLKMQIEVFFKEIFLYILETSTSSFDHKWMVIQTLTRICADAQSVVDIYVNY
DCDLNAANIFERLVNDLSKIAQGRGSQELGMSNVQELSLRKKGLECLVSILKCMVEWSKD
QYVNPNSQTTLGKEKSSDQEMSEIKHPETINRYGSLNSLESTSSSGIGSYSTQMSGTDNP
EQFEVLKQQKEIIEQGIDLFNKKPKRGIQYLQEQGMLGTTPEDIAQFLHQEERLDSTQVG
EFLGDNDKFNKEVMYAYVDQHDFSGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYL
ECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEY
LSAIYNEIAGKKISMKETKELTIPTKSSKQNVASEKQRRLLYNLEMEQMAKTAKALMEAV
SHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVGLQDCDDTEVASLCLEGIRCAIRIACI
FSIQLERDAYVQALARFTLLTVSSGITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILK
CISQLELAQLIGTGVKPRYISGTVRGREGSLTGTKDQAPDEFVGLGLVGGNVDWKQIASI
QESIGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELLSTTHPRMFSLQKI
VEISYYNMGRIRLQWSRIWEVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELAN
FRFQKDFLRPFEHIMKRNRSPTIRDMVVRCIAQMVNSQAANIRSGWKNIFSVFHLAASDQ
DESIVELAFQTTGHIVTLVFEKHFPATIDSFQDAVKCLSEFACNAFPDTSMEAIRLIRHC
AKYVSDRPQAFKEYTSDDMNVAPEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFE
IMKTYGHTYEKHWWQDLFRIVFRIFDNMKLPEQQTEKAEWMTTTCNHALYAICDVFTQYL
EVLSDVLLDDIFAQLYWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKTCNCTLDI
FKTTIPHALLTWRPMCGETAPPPPSPVSEKQLDTISQKSVDIHDSFQPRSADNRQQAPLA
SVSTVNEEVSKLKSTAKFPEQKLFAALLIKCVVQLELIQTIDNIVFFPATSKKEDAENLA
AAQRDAVDFDVRVDTQDQGMYRFLTSQQLFKLLDCLLESHRFAKAFNSNNEQRTALWKAG
FKGKSKPNLLKQETSSLACGLRILFRMYMDESRIGAWDEVQQRLLNVCSEALSYFLTLTS
ESHREAWTNLLLLFLTKVLKISDNRFKAHASFYYPLLCEIMQFDLIPELRAVLRRFFLRI
GVVFQISQPCEQELGINKQ
Download sequence
Identical sequences ENSCPOP00000013433 10141.ENSCPOP00000013433 ENSCPOP00000013433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]