SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013554 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013554
Domain Number 1 Region: 81-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000348
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 399-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000107
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 3 Region: 631-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000313
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 449-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000029
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 539-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000906
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 694-718
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000355
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number 7 Region: 492-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000358
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000013554
Domain Number - Region: 139-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0164
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013554   Gene: ENSCPOG00000015037   Transcript: ENSCPOT00000015184
Sequence length 802
Comment pep:known_by_projection scaffold:cavPor3:scaffold_119:400026:406095:1 gene:ENSCPOG00000015037 transcript:ENSCPOT00000015184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPFCVGGGRRLQGSSKSGPGKGSSRKEVQLPMLQDPPKLGMPVVHSGQTVPGQAPLCF
DPGSPASDRTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRVKCPNSGCWLEFPSI
YGLKYHYQRCQGGAISDRLAFPCPFCEAAFTSKTQLEKHRIWNHMDHPLPTPKPGPVSRP
VTISRPVGVSKPIGVSKPVTIGKPVVSRPIVVSKPVPVNRPVAISRHTPPCKMVLLTKSE
NKVPRATGKSSSKKRAADSLDTFPIPPKQARPENGEYGPSTTGQSAAFQLSTNPSNSSLL
LGSRPSMGKEVLRPTGPVSLPEEDPERTKHRRKQKTPKKFTGEQPSISGTFGLKGLVKAE
DKARVHRSKKLEGPGPEDMRKKVPATSIPVSKEIPTPVTHPAPGGPEEQWQRAIHERGEA
ICPTCNVVTRKTLVGLKKHMEVCQKLQDALKCQHCRKQFKSKAGLNYHTMAEHSAKPTDA
EASEGSEQEERERLRKVLKQMGRLRCPQEGCGAAFSSLMGYQYHQRRCGKPPCEVDSPSF
PCTHCGKTYRSKAGHDYHVRSEHTAPPPEESMDKTSEAEDLLGVERTPSGRIRRTSAQVA
VFHLQEIAEDELARDWTKRRMKDDLVPESARLNYTRPGLPALNPQLLEVWKNEVKEKGHV
NCPNDCCEAIYSSVSGLKAHLASCSKGDHLVGKYHCLLCPKEFSSESGVKYHILKTHAEN
WFRTSADPPPKHRSQDSLSPRREKKKSLVGGKKRGRKPKERPPEEPVPKLPPRRDDWSLG
GRDKGARGSTGRKVGAGKTTEK
Download sequence
Identical sequences 10141.ENSCPOP00000013554 ENSCPOP00000013554 ENSCPOP00000013554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]